SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009506 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009506
Domain Number 1 Region: 193-251
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 775-828
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000584
Family Hermes transposase-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009506   Gene: ENSOANG00000005972   Transcript: ENSOANT00000009508
Sequence length 901
Comment pep:known_by_projection supercontig:OANA5:Contig3654:19744:26613:-1 gene:ENSOANG00000005972 transcript:ENSOANT00000009508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRPPRPRSIQKSWFEQFPWLLANTEQTALFCSACREYPAVRDKRSRLIVGYTGPFKVET
LKYHAKSKAHRFCVSALAARDPVWAARFRGVRNLAGDPLLGPEYLFAADYPPGPDLDCPA
GLLQSPRPEPGDPPADGLVPPLFPDGVADLCPQDALADLRDPSTLSVLFDDPAEPFGQVP
GNLGPARGIRTSAELPVTFEDVAVYFTREEWGMLDKRQKELYRDVMRVNYELLASLGPAA
AKPDLISKLERRAAPWIKDPNGPKWGKGRPPALLASTGKKKKKMAAAAAAQEAAEQGAAE
EARPPPASPEETGASLPPAGSVDPEGDGPGRVKKTYRPRSIQKSWFGQFSWLITDPEETT
LFCSVCKERPSLHDKSSRLVKGYTGPFKVETLKYHEVSKAHKLCVNTAEARDEISSDLMA
NMEHFFNAAYSIAYHSRPLNDFEKVLQLLQSTGTMILGKYRNRTACTQTIISALDELDIP
FRRPGWVVGLGTDGTAMLSRRGGLVEKFQELIPQLVPVHCVAHRLHLAVVDACGGIDLVK
KCDRHIRTVFKFYQSSNKRLSELWPALARHLHGVAEAGGQIGHRAKGMLKLMRSFHFVKF
CHFLLDFLSVYRPVSEVCQREIVLVTEVNAALERAHGALETLLRQPGPKEEEFNGGFLDG
RLHGVPLDRADLAEQRFRADREKVILTGIGYLRQRFDADRSPQLKNVEVFDTMAWPAGLE
LAAFGNREILALARHFELSLPSGYREDGLLQEWLGLKAAAKNLPFSMLGKDALARHDRFP
LLSRLMAAVLCLPISTSCCERGFSAMNRIKTDERTKLSNEVIFMLVMIAVHLVALRSTTR
SPAIQHWYLTSSGRRFSHVYTAGGERGTGDGGNDGAGWDGASGPSRVPAGPVGRLWGRSG
E
Download sequence
Identical sequences F6XV23
ENSOANP00000009506 ENSOANP00000009506 9258.ENSOANP00000009506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]