SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009708 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009708
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-20
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009708   Gene: ENSOANG00000006092   Transcript: ENSOANT00000009710
Sequence length 87
Comment pep:novel ultracontig:OANA5:Ultra75:216318:217798:1 gene:ENSOANG00000006092 transcript:ENSOANT00000009710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMWRQCAHWLIQCRVLPPNHRVTWDSAQVCELAQALRDGVLLCQLLNNLMPHAVNLREI
NLRPQMSQVSRLALLGPVLKPRPDKPW
Download sequence
Identical sequences F6XQY7
9258.ENSOANP00000009708 ENSOANP00000009708 ENSOANP00000009708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]