SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011207 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011207
Domain Number 1 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 312-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 228-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 368-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 190-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 274-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000497
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011207   Gene: ENSOANG00000007040   Transcript: ENSOANT00000011209
Sequence length 531
Comment pep:novel supercontig:OANA5:Contig9799:6981:14009:-1 gene:ENSOANG00000007040 transcript:ENSOANT00000011209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTFEDVALYFSLEEWAHLDSSQRKLYRNVMWENYKNVVSLGILLPKPDLIALIEQGEE
LWGLEFHVAKERGSPKAIRRGDRTENLRDSSPGKRSYLAQREGLALGSRRSPCEDEARSS
TGRKRKCFSGTRDHSQRGGRPEKALPQELRSTQRPIPRKPGSSDQTSSLNEREKTLCWKG
QPRDPKGQNSYKCGNCGKSFDWKSRLVHHLRTHTGEKPYVCVSCGKDFSQSSALYRHQRV
HTGDKPYKCDECGIGFFEKSGLFRHRRVHTGDKPYKCDECGKGFSESFNLYVHQRVHTGE
RPYRCGECGKGFNQSSHLYVHQRVHTGDKPYKCDECGKGFNQSSHLYVHQRIHTGDKPYR
CGECGKGFSRSAHLYQHRRIHTGEKPYTCDECGKGFTRSAHLCVHQRVHSGKKPFKCEDC
GKGFSRSAHLYQHQRIHTGEKPYKCNECGKGFTRSSHLYVHRRVHTGEKPYKCDECGKGF
NQSSNLYVHQRVHTGDKPYKCDECGKGFSQSFKYYVHQRGHKEERLCGCRE
Download sequence
Identical sequences F7EY44
ENSOANP00000011207 ENSOANP00000011207 XP_007664142.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]