SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011470 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011470
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-44
Family Calponin-homology domain, CH-domain 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011470   Gene: ENSOANG00000007208   Transcript: ENSOANT00000011472
Sequence length 199
Comment pep:known_by_projection supercontig:OANA5:Contig8831:8364:16818:1 gene:ENSOANG00000007208 transcript:ENSOANT00000011472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDPELESRLAAWMVLQCGEGAEPPPPGREAFQRWLMDGT
ILCKLINSLHPTGQEPVPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRRGQSVIGLQMGS
NKGASQAGMTGYGTPRQIL
Download sequence
Identical sequences F6W4S7
ENSOANP00000011470 XP_001510435.1.37387 9258.ENSOANP00000011470 ENSOANP00000011470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]