SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011500 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011500
Domain Number 1 Region: 120-632
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.1e-153
Family Calponin-homology domain, CH-domain 0.00000000307
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000601
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011500   Gene: ENSOANG00000007227   Transcript: ENSOANT00000011502
Sequence length 639
Comment pep:known_by_projection supercontig:OANA5:Contig11890:2556:19339:1 gene:ENSOANG00000007227 transcript:ENSOANT00000011502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTAHISKDELEELREAFDKVDLNSNGFICDYELHELFKEANLPLPGYKVREIIQKLVL
DGDKNQDGRISFDEFVSVSAPDHCPHPSPYPGQAPGLSPAPGNLGWTLSLALQFLHSGVE
EEKFAFVNWVNKALESDGDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI
NKKKLTPFIVQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADI
ELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWTKISNFSSDIKHTQLVD
FSNSVKDSRAYFHLLNQISPKGQKEGETPIAISMSGFAEKDDLLRAELMLQQADRLGCRQ
FVTPTDVVSGNPKLNLAFVANLFNKYPALTKPDSQDIDWTLLEGETREERTFRNWMNSLG
VSPHVNHLYGDLQDALVILQLYERIKVPVDWTKVNKPPYPKLGANMKKLENCNYAVDLGK
NPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGQKANDDIIVTWVNRT
LGEAGKSTSIQSFKDKAISSSLAVVDLIDAIQPGCINYDLVKTGTLSDDDKHSNARYAVS
MARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRA
Download sequence
Identical sequences F6QQS1
9258.ENSOANP00000011500 ENSOANP00000011500 ENSOANP00000011500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]