SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011881 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011881
Domain Number 1 Region: 14-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-34
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011881   Gene: ENSOANG00000007466   Transcript: ENSOANT00000011883
Sequence length 141
Comment pep:known_by_projection supercontig:OANA5:Contig32658:5577:7502:1 gene:ENSOANG00000007466 transcript:ENSOANT00000011883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVHYVQGTVPSPGMSTMANRGPAYGLSREVQQKIEKQYDGELEQILIQWITAQCRRDVG
RPQPGRENFQNWLKDGTVLCELINGLYPEGQGPVKKIQASAMAFKQMEQISQFLQAAERY
GINATDIFQTVDLWEGQLGGC
Download sequence
Identical sequences F6W0X1
ENSOANP00000011881 ENSOANP00000011881 9258.ENSOANP00000011881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]