SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013138 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000013138
Domain Number - Region: 189-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000482
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013138   Gene: ENSOANG00000008269   Transcript: ENSOANT00000013140
Sequence length 214
Comment pep:novel supercontig:OANA5:Contig24924:2216:8372:1 gene:ENSOANG00000008269 transcript:ENSOANT00000013140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLNDPVQIVTVEEVASADEASSPPSPFAWQPLENQKGQVDERRWPETQPVAWQSEERRRS
KQMRKDYFKYKASRKSSSGHEGQERDCNPADGSPKPPVTQDDFERTETYSHGPFGLKPRP
GKYFREKFLARIGSAPHLTPCAHIMSPNALSLHPRSALLSFLPGKFPKHFSSRRVKNSAS
LHQTCEMIPKLSMAKCRRNVENFLDACKKLGVSQ
Download sequence
Identical sequences F6YL53
9258.ENSOANP00000013138 ENSOANP00000013138 ENSOANP00000013138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]