SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013528 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000013528
Domain Number - Region: 8-98
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00369
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013528   Gene: ENSOANG00000008506   Transcript: ENSOANT00000013531
Sequence length 135
Comment pep:known_by_projection ultracontig:OANA5:Ultra324:515421:522541:-1 gene:ENSOANG00000008506 transcript:ENSOANT00000013531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRETKSLRELFQKAESDLDYIQHKLEFEIMKSLPHSPSGEENPVTLLEELSEVKSRYKA
LCAQLEQVAKEQKESMTSICTTLDTTMKMVQQLQQQTNMELSPLDEEEQSALQKLRTHLT
HQASKGTDLHKAIVT
Download sequence
Identical sequences F6XKF4
ENSOANP00000013528 ENSOANP00000013528 9258.ENSOANP00000013528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]