SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013977 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013977
Domain Number 1 Region: 129-265
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-17
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 345-495
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 3 Region: 43-160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000916
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 4 Region: 270-385
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000518
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013977   Gene: ENSOANG00000008772   Transcript: ENSOANT00000013980
Sequence length 531
Comment pep:novel supercontig:OANA5:Contig14791:2005:13610:-1 gene:ENSOANG00000008772 transcript:ENSOANT00000013980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTNMVSVEGLAKLVDPSQLTDEFDGSLDYNHEAWIDLRGALEAFFHSAVHLLARLEDLQE
MLARKEFPVDVEGSRRLIDEHAQLKKKVLRAPVEELDREGQRLLQCIRCSDGFSGRNGLP
GSADFQSLVPKVTSLLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHN
KALFLQSHTEIGVSHQHALDLRTLHNHFTMNSMNAYVNINRIVSVASRLAESGHYAAQQM
KQISGQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLWWVDTWCKMCSDGGLPADMQS
LELAVHHHQALYEQVTQAYTEVSQDGKALLDVLQRPLGPGNAESLTASANYSQAVLQVLD
VVHEVLHHQRRLEGIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKS
LHRARALQKRHDDFEEVAQGWQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRV
QDFVRRVEHRKLLLDMSVSFHTHTKELWAWMEDLQKELLEDVCADSVDAVQ
Download sequence
Identical sequences F6XFF0
ENSOANP00000013977 9258.ENSOANP00000013977 ENSOANP00000013977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]