SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014489 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014489
Domain Number 1 Region: 4-121,153-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.2e-74
Family Calponin-homology domain, CH-domain 0.0000391
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014489
Domain Number - Region: 342-445
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000791
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 275-363
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0396
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014489   Gene: ENSOANG00000009101   Transcript: ENSOANT00000014492
Sequence length 505
Comment pep:novel supercontig:OANA5:Contig283:793489:809669:1 gene:ENSOANG00000009101 transcript:ENSOANT00000014492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLAEQEHTQKKTFTCWINSQLAKHVPPSAISDLYTDIKKGHVLLDLLEVLSGQQLTREK
GTNPFQCRSNIEQVLVFLKNRSIKLINIHVTDIIEGNPSIVLGLIWTIILHFHIEELAWT
LSCSYNQPSLDCVTVVDLSPTSSPPAKRRSKAQARWKMSAKKALLLWAREQCAPPRHCTV
SITDFKSSWRNGMAFLAVIHALRPDLIDMNIVKDRSNRENLNEAFRIAECELSIPRLLEP
EDVDVLHPDEKSIMTYVAQFLQYSKDLPVAEDEGKVKDAIVWLTLQEEKLKKLSVDSESE
TYYKKYQDMHSFLETFNEEKKAFLSVLSLKKNMVGMTDDQLHLREAWDRLTDQINEWRAK
LDHILPSPLDRVEAWLQEVEHLMAEDLPAFQDYSNAMTFVEEKLHLLKGLMDNFDCHLNT
LLAFENKDQKHMPLIPPDKLEEMKRRLQFNDVKGTDFIALLEFHYYLGSVQGLIDEVKSK
LHFWNIKYGTKESVELLLQDWHLFG
Download sequence
Identical sequences F7G733
ENSOANP00000014489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]