SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014570 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014570
Domain Number 1 Region: 212-343
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000222
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 2 Region: 80-216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000509
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 3 Region: 636-760
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000475
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 4 Region: 529-632
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000095
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014570
Domain Number - Region: 820-882
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00141
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number - Region: 459-562
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00142
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 358-432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.056
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014570   Gene: ENSOANG00000009154   Transcript: ENSOANT00000014573
Sequence length 989
Comment pep:known_by_projection ultracontig:OANA5:Ultra378:1811534:1966832:-1 gene:ENSOANG00000009154 transcript:ENSOANT00000014573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQEILGQTEERWEQLAPANAMTQRSQNEFDSSLENAVAWMKAVQERLQINDNTKGPRSAL
EARLRETEKICHLEPEGQVKMDRVLKSADTLLGSCGEDQKPAVLTKLKDIKTQWEDTVVY
ITHCHSRIEWVWLHWNEYLRAQDEFYRWFQSMRVTLEPALELQLGWKEKQWQLSHSEVLL
SNVQNQAVLLDRLLEEAASLFNRIGDPSVDEDVQRKMRAEYEEIKAKAQDRVKLLEKITG
EHKEYKEKVDAFQGWLGGMTERVSSRLGRANQSTLENQLKDLRDIARDFLRGEESLKNLE
RQSVGVIQNTSPLGTEKITRELEELRKALEKLKLLCKEEEERLLKALKLDGSYRSQAQLL
GTEVAEFRQEIQRLAKSLEPGEKARDEEELIALWRKYTVTRSALVAEEAKAEKLKAQLKE
LIQFSQDGQPLSANVVTALQDFQSVKGKTAKLLTSTGMELAQGFQHLLRDFQLWKTEAQR
LVNITASVPDRSMIPTFLPQLEAALSESSDLKEKLTAVLLKRDLLSGIFGEERAKSLVAE
VTDATKDRDRLHNCLLQRKSKLLNMLSQQKDFDAAFEPLQKRLAALRIRVAVEKEPQSDL
RGKQAQLQKLQRLQEDLLELAVQMDDLKLLVQSEPSHQHKMSQLSSDYHTLKRSLEMMLE
QSQQCVEEHWLFSNKRLELQQWIMVVKQKLESYQEDSDGWKVETRAGEIERLSAEFPNKE
VQLHLVEAHGQRVMEQSSPGGVALIQEELKQLKESWNSLRVLEEMLSGLVRSWQLKRVNA
DSGKKKVMTNHNPKPGSFRHAGNAVDGHYGWGELRDGEGDFNSGLEKFEQWLQVENAKLA
RIIEVKVPTPEDVKARKSKLQELQSRIPEGQDLFENLLHLQSTKGNSEDLEDVRYRWMLY
KSKLTDSIHLPIHNSSEGSAGFRKSRSGGLCAFLERVCCMALPLQLLLLLLLLLLFLLPL
EEETHSCALSNNYARSFNLMLRYNGPPPT
Download sequence
Identical sequences F7EJP0
ENSOANP00000014570 ENSOANP00000014570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]