SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014942 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014942
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-76
Family Calponin-homology domain, CH-domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 232-354
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 468-589
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-32
Family Spectrin repeat 0.00000052
Further Details:      
 
Domain Number 4 Region: 349-464
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-24
Family Spectrin repeat 0.000000534
Further Details:      
 
Domain Number 5 Region: 593-704
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.000000628
Further Details:      
 
Domain Number 6 Region: 794-864
Classification Level Classification E-value
Superfamily EF-hand 6.82e-18
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 
Domain Number 7 Region: 761-809
Classification Level Classification E-value
Superfamily EF-hand 0.0000758
Family Calmodulin-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014942   Gene: ENSOANG00000009397   Transcript: ENSOANT00000014945
Sequence length 865
Comment pep:known_by_projection supercontig:OANA5:Contig2568:19439:70482:-1 gene:ENSOANG00000009397 transcript:ENSOANT00000014945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERRLSKPDRGKMFHKIANVNK
ALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQ
RKTAPYRNVNIQNFHLSWKDGLGLCALIHRHRPDLIDYSKLNKDDPVGNINLAMEIAEKH
LDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERL
MEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLE
INFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHL
AEKFKQKASTHETWAYGKEQILLQKDYESASLTEIRALLRKHEAFESDLAAHQDRVEQIA
AIAQELNELDYHDAANVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFA
KRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQAIMAIQNEV
EKVIQSYNIRISSANPYSTVTMDELRAKWDKVKQLVPVRDQSLQEELARQHANERLRRQF
AAQANAVGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKTNIDKLEGDHQLI
QEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEIETQILTRDAKGITQEQMNEFRASF
NHFDRVRRARRLVGAIPALRREARSWDVPSCLRAITPSVGGEAEFARIMTLVDPNGQGTV
TFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILADELRRELPPDQAQYCIKRMPAY
SGPGSVPGALDYAAFSSALYGESDL
Download sequence
Identical sequences F7F6L1
ENSOANP00000014942 ENSOANP00000014942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]