SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000015398 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000015398
Domain Number 1 Region: 196-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000226
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000015398
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0025
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 146-197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0142
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000015398   Gene: ENSOANG00000009703   Transcript: ENSOANT00000015401
Sequence length 274
Comment pep:novel supercontig:OANA5:Contig6903:16935:25621:1 gene:ENSOANG00000009703 transcript:ENSOANT00000015401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSTMMWVSGARGGRGRRGKLLIRGAKYTACFLLPRRHPESPPGLAWPLELSRAAAERS
MARPAPSPVLWALLLLLLVPAPARCEPGQPEKTRSTRSLQDRQPRITSERGSLVFRTDSD
GDIEFRTGFQGRIKVNDRDLGTSLLQIQGNAAEITEFKRVGAAFMHNVSSRLSQLQSRLG
DLENRFQSLQQAAQRRVCSSNPCQNGGTCLNLLDSFFCLCPPSWKGPVCSADVNECETFA
GSPYSCQNGATCVNTAGSYSYFLTCHRGRRASSL
Download sequence
Identical sequences F6RZC3
ENSOANP00000015398 ENSOANP00000015398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]