SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000015547 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000015547
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Hook domain 1.44e-52
Family Hook domain 0.000000435
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000015547
Domain Number - Region: 485-554
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 159-207
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0471
Family Outer membrane lipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000015547   Gene: ENSOANG00000009802   Transcript: ENSOANT00000015550
Sequence length 671
Comment pep:known_by_projection supercontig:OANA5:Contig3128:26854:59467:-1 gene:ENSOANG00000009802 transcript:ENSOANT00000015550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTFNTAAPCRDVQELTNGVAMAQVLHQIDAAWFDEPWLARIREDVGDNWRIKASNLKKI
LQQIMSYYHEGLGQRISEELVPDLSRITEDSDPTELGRLLQLILGCAVHCEKKQEHIQNI
MTFEESVQHVIMTAIQELMRKEHGAGDLEQQLRMALENLQEALAEKEELKQRCQELDVQV
AALQDEKNTLLSENELMNERLDQLDNSFDDPGTVVAKKYFHAQLQVEQLQEENFREGRLE
AAKDDYRLHCEDLEKQLIEFQHRNDELTGFAEETRALRDEIDVLRLSSDKASKLESTVEV
YREKLRDLQDLRQQVKTLQDTNMLYMQNMVSLEEELKKANAARAQLETHKRQIQELHAKL
TGESKRADTLAFEMRRLEEKHEALLRERERLIIQRDTLKETNEELRCSQMQQNHLNLAGA
SAAGSQGNLAAEMMPVECREVKGFAQVEQETSLFPVALSLPERLAQRSARGGMTAVSSRL
SEEHIGELQRQVEDLQKALQDQGAKAENEGSSKLKQKLEAHMEKLTEVQEELQKKQELIE
DLQPEGQHGVQRSTTANISLLSEHESCLWLTTVFTAGQHPPLTVFGAREVHLLLVLVSLQ
GECKVAKFRDYEEKLIVSAWYNKSLAIQKLGMESRLIGHGAGPGKSFLAQQRHITNTRRN
HPGPAPAATSD
Download sequence
Identical sequences F6ST67
ENSOANP00000015547 9258.ENSOANP00000015547 ENSOANP00000015547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]