SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000015809 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000015809
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 300-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 188-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 161-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000176
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000015809   Gene: ENSOANG00000009973   Transcript: ENSOANT00000015812
Sequence length 357
Comment pep:known_by_projection ultracontig:OANA5:Ultra330:1703597:1707887:-1 gene:ENSOANG00000009973 transcript:ENSOANT00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNESGPTGSNQTPVTFEDVAVYLTREEWKLLGPSQRDLYRDTMLENYRHVVSLGYPAAKP
AVIAQLERGMELCFRNLPSTKGRRHLRDACRRGEIRRPEQIIPQVRESPGAISRSLKEDG
PGDPEFGESSGGGSRSQPEGMRLWNYCALNRKRDDECSRNSQKKPCECKTCGKTFSKNSK
LIEHQRTHTGEKPYVCQECGRAFSRRSSLMKHQRTHTGERPYFCQECERTFSERINLISH
QRLHAREKCYKCGQCERTFSWRSQLITHQTVHTGKKPPKCDTCGKVFSQMASLVRHRVIH
TGEKPYVCKECGKAFNRRFNLLCHQRIHTGEKPYECKICGKSFKYHSSLNEHRKTHS
Download sequence
Identical sequences F7AIS6
ENSOANP00000015809 9258.ENSOANP00000015809 ENSOANP00000015809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]