SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000015869 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000015869
Domain Number 1 Region: 28-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-86
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 4176-4325
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-28
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 3187-3347
Classification Level Classification E-value
Superfamily Spectrin repeat 3.7e-28
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 4623-4772
Classification Level Classification E-value
Superfamily Spectrin repeat 3.26e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 277-393
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-25
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 6 Region: 5126-5202
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.26e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 7 Region: 4766-4883
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-22
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 8 Region: 3953-4116
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 4832-4959,4986-5017
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-22
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 10 Region: 4415-4554
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 3733-3891
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-22
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 2752-2909
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 13 Region: 3340-3457
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 3408-3555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-18
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 4524-4626
Classification Level Classification E-value
Superfamily Spectrin repeat 3.08e-18
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 3516-3670
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-17
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 17 Region: 2419-2547
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-17
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 18 Region: 618-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 19 Region: 1862-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 20 Region: 1190-1320,1347-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 3.56e-16
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 21 Region: 2966-3126
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 22 Region: 5037-5117
Classification Level Classification E-value
Superfamily EF-hand 6.98e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 23 Region: 4299-4406
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000393
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 24 Region: 2646-2763
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000302
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 25 Region: 1972-2114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000864
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 26 Region: 2327-2435
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000036
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 27 Region: 2188-2305
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000648
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 28 Region: 1729-1852
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 29 Region: 558-647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 30 Region: 1465-1623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000187
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 31 Region: 1392-1502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000259
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 32 Region: 2549-2652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000193
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 33 Region: 2085-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000393
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 730-832
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000107
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 35 Region: 890-968,1066-1123
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000035
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000015869
Domain Number - Region: 3101-3179
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00446
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000015869   Gene: ENSOANG00000010005   Transcript: ENSOANT00000015872
Sequence length 5392
Comment pep:known_by_projection supercontig:OANA5:Contig704:132254:333272:-1 gene:ENSOANG00000010005 transcript:ENSOANT00000015872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSAGVAPVRAGGPGSPPWPDFREERALNAHLVRRMCCMDERDRVQKKTFTKWVNKHLM
KVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKL
VNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTG
IKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAERLGVTRLLDA
EDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISATEVDSRWQEYQNRVDSLISWIKQH
TILMSDKSFPQNPVELKALYNQYIHFKETEIPAKEREKGRIEELYKLLEVWIEFGRIQLP
QGHHPNDVEEEWGKLILEMLEREKSLRPAVERLELLLQIANKIQNGALSCEEKLTLARNT
LQADTAHLELGQSVQYESEVVTYLQEGEGLIRQLQVDLQILRDENYYQLEELAFRILRLQ
DELVTLRLECTNLYRKGHFTTLELTQPSALTTAPSKAEPLTKGTHTTSASWFRKPMTRAE
LVAISSSEDEGNLRFVYELLAWVEEMQMKLERAEWGSDLPSVESQLETQQHIHTSVEELG
SSVQEARMYEGKMSQNFRTSYAETLGKLETQYCKLMETSGSRLRHLESLHRFVSRATAEL
IWLNEKEEEELAYDWSDNNPNVTAKRNYFSELRMELEEKQDVFRSLQDTAELLSSENHPA
KQTVEAYSAAVQSQWQWIRQLCLCVEQHVKENTAYFQFFSDARDLEAFLRNLQDSIKRKY
SCDHNTSLLRLEDLLQDSMDEKEQLIQSKSSIASLVGRSKTIVQLKPRNPDHMLKNTISV
KAICDYRQIEITICKNDECVLEDNSHRTKWKVISPTGNEAMVPSVCFLIPPPNKEAVEMA
NRVEQSYQKVMTLWHQLHVNTKSLISWNYLRKDLDLVQSWNPEKVRSLPPGECHQTMKSL
RAHYEDFLQDSRDSELFSVADRLRLEKEVDGCKEHFQRLLESVENEDKDETVAKNYISEL
KNIRLHLEDCERRVVGRIKSPSGSWADGDALQDAALRVAEQERTQEDLQRLKSELDDVSS
RCSGFLQRSPSGPSAPTLRSELNLLVEKMDHVYGLSSVYLDKLKTVDVIVRSAQAAELLV
KGYEIKLSQEEAVPADLSALQTHRSTLQQWLSDVKDKSSVFSTLDEELAKAKVVGEQLCR
LTPERSLDLERYQEKGAQLRERWQRVGVQMETRSSDLESIQEVLRDYRACHGALIQWIEE
TTAQQEVMKPGQAEDSRVLSEQLSQQTALVAEIERNQAKLDQCQKFSQQYSTTVKDYELQ
LMTYRAFVESQQKSPGKRRRMISSSDAITQEFMDLRTRYTALVTLTTQHVKYISDALRRL
EEEEKVVEEEKQENVEKVKELLGWVSSLAQTTQGKTKGRDLTDIEKSISEQQALAEELAM
KKEQISDAIKTAQIFLAKHGHKLSDREKEQISEQLDALKETYHQLCDSSADQLQQLQSQL
AQETEQKSLQEQRAVCHEKLEGLCHWLGEAERTLVDRQRRAASKEDLSALQQKQSDLEDL
QKDVQDHAGAFADAIKATEEFLEENRTKLNPSELASLREKLRQAKEQYRALRERTQTAQK
ELDGEVTAAVRQETEKTKAANELEENQRKIDSLLDWVSSLESPGGPSKLSLPTAGQTPGG
RPGRGSQDTVDGQGGVDRAEEALDQQYESLKARHQELLSQQQNFILATQSAQAFLDQHGH
NLSPEEGSRLRRRLAELKERYSASLARSETELKQVQTLRDELRKFLRDHGEFETWLEQSE
KELEGMRREDGDLASLLRPMLLRQGSFSEDVISHKGDLRFITMSGQKVLDTEGGSGPSAA
GVLVKDRLEDATRRYTALHSKCSKLGSHLNTLLDRYQQFQGSTDGLQAWMQQCEAEVERL
LADTVASDPKILQQQLASTKEQQLQGDLAEHQVPVEKLQKAARDLMEIEGRPAPDPSHIR
ETTDSILSRFQSLSRRMAERSDLLQKAIAQSQSVQEGLESLLQSIAKVEGGLEGEQVASM
SSAAIQEALATNTKLKQDIARQKSSLEATREMVTRFTETVDGATAAGLRGQLAEASERFD
RLCRRQREKEAALKELLPKVEQFERLTEKLRQFTDSRARSLASGNQPDRDIAHFSQQIQE
LNLEMREQQENLDALEHLASELSSCGISTDSSQHQETVQKLKKDFTELQKTAREREKETS
SCQEQLDEFRKLVWGLRKWLKECEGSVPSAEATVGTQELEKQIEHVEGLLEGWAGKGAQV
EEVNRRGTALENLIVDITAPETQAKTGSVLPALGASVGSVNGYHTCKDLTEIQCELSDVN
QQYESLGGVLRGRRDSLLAVLSRMREVGEEARSALKWLESTERNLEALDATSSPTKTETV
RAQAEHNKAFLAELEQNSPKIQKVKEALADLLEKYPNSQEAENWKKMQEELNSRWARANE
VTVARQQKLEKSANQLDSFQAAEAQLRPWLKEKELMMSVLGPLSIDPNMLNAQKQQVQFM
LKEFEARRQQHEQLNQAAQGIFAGPGDASPSTGQARDQLEGINQKWVELTERLNSRSSQI
DQAIVKSTQYQELLRGLAEQVKAVGQQLSGQSAISAQPDAVKQQLEETSEIRSDLERLDH
EIAEAQALCDQLSLLIGEQYLKDELRKRLETVALPLKGLEDLAADRLNRLQTALASTQQF
QQMFDELRAWLDDKRNQQARAGPTSAKLERLQAQLQEQEEFQKSLNQHSGSYEVIVAEGE
TLLLSVQPGEEKAALQGQLAALRSHWAELGKHAADRQARLKDCLQKAQKYRWYVEDLVPW
IEDCKGKMSGLQVTLDPAQLEATLLRAKGLLSDVEKRRSLLELLNGAADLLLDSAQADED
DVRDEKAALERTVDAVTEELRAKTGSLEEMAQRLREFQESVQTVEKKLDGARHQLELLDA
MGPQACSNKNLEKLRAHQETLQALEPQVDYLKRFTRGLLEDAPDGQGPSRLLHRAEAAER
DFASVRHRVDEGCRAMESRLDGIGQFHGRVREMFSQLADLDDQLDGMGAVGRDADSLQSQ
IEDVRLFSGRVRGLKADVAAAREECRRMLDEEGSPDLLGLKRELETLNKQCGKLMERGGT
RQEQLETTLARVEDFYNRLKELNRMTTAAEESEALQWVVGTEVDAINQQLADFKMFQKEQ
VDPLQLKLQQVNGLGQGLIQSAGKNCDVQGLEHDMEAINARWNTLNKKVAQRIAQLQEAL
LHCGKFQDALEPLLSWLTDTEDLIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVEM
IQAEGGRIAQAAEPADQEKIVGQLESLEGRWAGLLHKAAARQRQLEEILVLAKEFHETTE
PISDFLSVTEKKLANSEPVGTQTAKIQQQIVRHKALEDEVESRAAGVQLAVGVGRSLSSL
TGPTERGALAERLDALQARYREVRERCGRRAALLGQALCDARLFGDGEVAVLNWLAEVED
KLGSVSVKDYKRDVLQKQHADQLALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQE
KLDGIKTRYADITATSSKALRTLEQARQLATKFQATHEELTGWMNTVADELAASGGQSPT
GEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSEANEQYKA
VSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLAALGPIRLEQDQTTAQLQVQ
KAFSIDIIRHKDSMDELFSQRDEIFGTCGEEQKAMLQEKTESLVQQYEAVSQLNSERYAR
LERAQVLVNQFWETHEELDPWIQETQTLIAQLPPPAIDHEQLKQQQEDMRQLRESIAEHK
PHIDKLLKIGPQLKELNPEEGEMVQERYRAAEAVYARIKEEVRLRALALDEAVSQSAQIA
EFHDKIEPMLETLENLSSRLRVPPLIPAEVEKIRECIGDNKNATVELEKLQPSFGALKRR
GEELIGRSQGPDKDLAAKEIQDKLDQMVFFWEDIKARAEEREMKFLDVLELAEKFWFDMA
ALLATIRDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFA
CGETEKPEVKKSIDEMNNAWENLSKMWKERLERLEEAMQAAVQYQDALQSMFDWLDNTVI
KLCNMPPVGTDLNTVKEQLNEMKEFKTEVYQQQIEMEKLNHQGELMLKKATDETDRDIIR
EPLTELKHLWENLGEKITRRQHKLEGALLALGQFQHALEELMGWLTHTEELLDAQRPING
DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRTRLETMNQCWE
SVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMENQLSASKPTGGLPETAREQLDA
HLELHSQLKAKEELYGQLLDKGRLMLLSRQDSGTGSKTEQSIALLEQKWQAVSSKMEERK
SKLEEVLSLATEFQNSLQEFINWLTLAEQSLNVAASPSLILNTVLGQIDEHKVFANEVNA
HRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSVERGRALDDARKRAK
QFHEAWKKLIDWLEDAEKLLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRT
GRALKEKALLPDDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALV
DWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRD
DTTWVKGQLQELSTRWDTVCKLSVSKQTRLEQALKQAEEFRNAVHMLLEWLSEAEQTLRF
RGALPDDTEALQSLIDIHKEFMKKVEEKRVDVNAAVGMGEVILAVCHPDCITNIKHWLTV
IRARFEEVLTWAKQHQQRLEAALSELVANAELLEELLAWIQWAETTLIQRDQEPTPQNID
QVKALISEHQAFMEEMTRKQPDVDRVTKTYKRKASEPTHAPFIEKSRSNLGKSLSQPTPP
PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKK
YMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGD
GYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDS
QQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLELREKFILPEGVSQGMTP
FRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPATGTKVTPTTGSKLKRPTF
HSSRTSLAGDTSNSSSPVSTGAKTSRADPKKTASRPTSRAGSRTGSRASSRRGSDASDFD
LLETQSACSDTSESSTAGCQGSARRGLTKPSKIPTMSKKTTTATSKTPGPKR
Download sequence
Identical sequences F6YYH0
ENSOANP00000015869 ENSOANP00000015869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]