SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000016486 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000016486
Domain Number 1 Region: 163-393
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-37
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000016486   Gene: ENSOANG00000010397   Transcript: ENSOANT00000016489
Sequence length 440
Comment pep:known_by_projection supercontig:OANA5:Contig12845:3485:18570:-1 gene:ENSOANG00000010397 transcript:ENSOANT00000016489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFRRKEFRGKLAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLKEETADRLPDII
YPGRASTFYVQSTVLSAGVDTGIRLSHDYIDTEALLCGDNVNQNNLLSYAREAADFATDY
QLPSLDFAINHYGQPDVAMFDFTSMYASENAALVRERGSCRLLVALVGDSLLEPFWPMGT
GCARGFLAAFDTAWMVKRWNQGSPPLEVLAERESLYRLLPQTTPENINKNFDQYTLDPGT
RYPNLNSTCVRPHQVKHLYITQELHHFPLERASSVRRSISLARRESDIRPNTLLSWCQKQ
TEGYWRVEVTDLTTSWQSGLALCALIHRFRPNLIDFDSLQEEDVAGNNQLAFDVAERELG
IPPVTTGEEMASAREPDKLSMVLYLSKLYELFEGLPLRAVGKASWRRYSTGQNNALFSDN
STVFNSHLNLILPRKRTPRV
Download sequence
Identical sequences F6YRU3
ENSOANP00000016486 ENSOANP00000016486 9258.ENSOANP00000016486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]