SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000016981 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000016981
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.37e-62
Family Calponin-homology domain, CH-domain 0.000000809
Further Details:      
 
Domain Number 2 Region: 418-552
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000535
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 3 Region: 321-363
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000206
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000016981   Gene: ENSOANG00000010705   Transcript: ENSOANT00000016984
Sequence length 573
Comment pep:novel supercontig:OANA5:Contig48:3149992:3164832:-1 gene:ENSOANG00000010705 transcript:ENSOANT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERDRVQKKTFTKWVNKHLIKHWRTEAQRHISDLYEDLRDGHNLISLLEVLSGDTLPRER
DVMRNLRLPREKGRMRFHKLQNVQIALDYLKRRQVKLVNIRNDDIADGNPKLTLGLIWTI
ILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTASWRDGRLFNAIIHRH
NSVSVPLNLGDLLESLVGAPSPRLRFLGAPTILVSPKHRLRVNHTAVGPVVARSSDSVLG
VEAGQDLVXAVTFAPVVGHLLLLLLVQPHQLLGGSRHEAVQVLQAAQASFGPKRMWREVI
RKAKDQERGDPDVSPSHPQGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEF
ERLECLHRIVSKLQMESGLCEGWIHTLLQSDIRLLNAGKAPQRAGEVERDLDKADGMIRL
LFNDVQALKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKSGATMTSQVSQTTLQSAQ
RRPELEDVTLRYLQDLLGWVEENQRRLDAAEWGVDLPSVEGQLGSHRGLHQSIEEFRAKI
ERARADESQLSPATRGAYRDCLGKLDLQYAKLL
Download sequence
Identical sequences F6SC10
ENSOANP00000016981 9258.ENSOANP00000016981 ENSOANP00000016981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]