SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017265 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017265
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-80
Family Calponin-homology domain, CH-domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 1013-1161
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-22
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 2753-2880
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-20
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 2060-2217
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-18
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 347-451
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-17
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 527-664
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-17
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 7 Region: 2900-3031
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 8 Region: 2526-2673
Classification Level Classification E-value
Superfamily Spectrin repeat 4.25e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 9 Region: 459-560
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000777
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 10 Region: 1832-1976
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000259
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 11 Region: 1222-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000605
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 12 Region: 783-940
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000679
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 1639-1781
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 14 Region: 1469-1579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000196
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 15 Region: 2213-2335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000224
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 16 Region: 2293-2424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000884
Family Spectrin repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000017265
Domain Number - Region: 2472-2542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017265   Gene: ENSOANG00000010897   Transcript: ENSOANT00000017268
Sequence length 3043
Comment pep:novel ultracontig:OANA5:Ultra98:680509:1238258:1 gene:ENSOANG00000010897 transcript:ENSOANT00000017268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWYEEAEDCYEREDVQKKTFTKWLNAQFSKSGRQHIENLFSDLQDGRKLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALQVLQRSNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMQNMMAGLQQTNIEKILLSWVRQSTRNYPQVNVVNFTTSWSDGLAFNALLHSHRPDL
FDWNSVSGQKSATQRLDHAFNLAKQHLGIEKLLDPEDVATAYPDKKSILMYVTSLFQVLP
QHVSLEAIREVERLPWQPAEDTSGERVRLHHQTHHQMHYSRRITFSLAQELMRTSSSSPQ
PRFKSYAFTQAAYVTSNPPESSHPPQQLGRPGDESVGGPSAEADLDAYQTELEEVLTWLL
SAEDALQAQGEVSADVEEVKEQFHTHEGYMMDLTARQGRVGHVLQVGSRLVAAGKLSEEE
ESEIQEQMNLLNSRWETLRVASMEKQNNLHKVLMDLQNQQLKRLADWLTQTEERTRKMAA
ETLGPDLEDLKRQVEQHKALQEDLEQEQVRVNSLTHMVVVVDESSGDKATAALEEQLQVL
GDRWANICRWTEDRWAVLQDILLKWQHFTDEQCLFDAWLTEKEVAIGNINLTGFKDQDEM
VTNLRKLSALKGDLERKKQTMDRLCSRSQALLAAMQNKDVARKMEAWLERFAQRWDSLAQ
KLERSSVQISQAVTAAQHSLTQTTVMETVTMVTTREQISVKQAKEGLPQPPPQKKRQVVV
DSEIRKRNLRLDVDTTELHSWITRSEAVLQSPEFAVFRKEGNLSELQEKVHVIERERPEK
YRKLQDANRSAQAVLEQMVTEGADVEAVRRAGEQLNGRWMDFCRLLADRLSWLEYQGSIL
TFYKELQELEQAVSSAESWWRSQLPPAADTAAVRTQLESCKDEGARLSALQPRIEQLQLQ
SRVLKEREQVPVFLDADLLAFTNHFQHVLANVRDREKQLQTHEVFDSLPPTHYQETMKTV
LMWIERAETKLSVPQVTVTERETMEQRLRDLKALQRALQEQQPGLDSLGLAVEELSQKAS
RQMGQKYRSEVAGVLSRWRKSSAQVAEAGQKLEEQLAKLQQYQNDIKTLKKWMAEVDVFL
KEEWPALGDSDVLEKQLEQCTVLVNDIQTLRPSLSSVNETGQQMQSEAESRVASGLEAEL
TELNVQWDHICQQAYARKEALKGGLDKTVSLRKELSEMHEWISQVEEEYLERDFEYKTPE
ELEGAVEELKRAKEEVAQKEAKVKVLTESVKSLVSRAPPAAHGAFRKELDVFIADFQRLG
SRLHGKCKTLEEVWACWCELLSYLETENKWLDEVALKLKATENVSGGAEDISEALDSLER
LMQHPEDNRNLIRELAQTLTDGGVLDELIGEKVERFNSRREELLTEAVRRQKVLEQSIQS
AQEIDKTLRLIQESLAVADRQLAAYLADRVDAAQVPQEAQKIQAEFTSHEVSLEEMKKRS
QGKGATQRVLAQIDAAQKKLQDVSVKFRLFQKPANFENRLQEGKRILDEVKTQLPALEMK
SVEQEVVQSQLDHCMKLYKSLSEVKSEVETVIKTGRQIVQKQQTENPKDLDGRLTALKLH
YNELGAQVTEKKLQLEKCLKLSRKLRKESNAVTEWLAATDVELTKRSALEGIPINLDAEL
SWGKVTQKEMEKRQIQKKTIADLGESLKAVLGKKEGLVDDKLSLLNSNWRAVTARLEEWS
NLLLEYQRHMEAFEKNVAHITAWVNRAETLLDESEKKKPQQRDEVLRRLKTELNDTRPKV
DSVRDQAANLMAYRGDHCRRVVEPELAQLDRRFAAVAQRIQPEKVSIPLKELEQFNSDIH
KLLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVKELLQRGDALQQSILDERKREEIKTKQ
QLLQTKHNALKDLRSQRRNKALEISPQWYQYKRQADDLLKCLDDIERKLASLPDPRDERK
LKEIDREWQQKKEDLKAVNRQAESLSGAGAARAVEPTRIRLSQRWREIESKFAQFRRLNY
AQIQTVYEETATVMAKDPASEASSAPSAYLVELLRLSRVLSDMGRLLRSPDLSAKDFENL
FKQEEALKSVKEQLTQWSEQLEAARRQEEAALRSATPEERLEIPAALTRLGCQWQEVNAE
YGERQGRFDRCVERWRHFHYEMKIFNQWLSEAERFLAKTQTRENVDRAKYKWYLKELQDG
VGRQTTVIRALNATGEEITAQASVTDADLLKDKLETLNVRWQKVCRQLAERNKRLEEEKN
ILSEFGDDLKEFVSWLEESESIVALPLEPGNEEQLAEALGKVKSRVEELPPRQEILKKLN
VTGKGALTSVATPPGEQDQLDSQLQAANLRWTQVSQDLPEKQKEIELLLKSFGQFEDQLN
QLTEWLSPLKSRLEFYHQTGQAEAPDIKDTEAAVRAKRPDVEGILSKGQQLYKDKPASQP
VKRKLEQLSSDWTTVDRWLQELRRKPTATTLGVVPPGIVAGRTPPVEAQTLVTKGTTVSK
KMPSSLPPEMPALADFNRAWAELTDWLTLLDQVIKAQRAMVGDPEDIGGLMVKLKTGLQD
LEQRRPKLEELITAAQNLKNKTGNQEARAVITDHIEKIQSQWEEVQEHLQGRKQQLSEML
KDSTRWLGARQEAEQLLDKTRAGLEAWADVPSSAEAVQGRIAEAKRLAGELHRGQAGMDG
ANDLALKLLRDYSADDTRKVQMMTDTLNATWTSVSKRLSEREADLEAAQRLLQRFPLDLE
AFLAWLAEAETTANILQDASHEDRTLEDPQAAAQLRRQWQDLQEEIEAHTDAFHSLDENG
QKILRSLDGSEDAVLLRRRLDQMNLKWSELRKRSLNIRSHLEAGSDQWKRLHVSLQELLA
WLQLKEDELSQQPPVGGDSPTVQKQNDTHRAFKRELKTKEPVITSALESVRTLLSEQPAG
GPERPFLESRGNVDPAQKAGPLLRKQADDVAAQWEALSLRAAAWQRQIDEALAGLRGLQE
AADELDGKLRRAEVTAQAWQPVGDLLVDSLQDHLEKVKALGAEVEALKENVNHVNDLGHQ
LAASDIPLSPCNLNRLEDLNSRWRLLQVSASQSARQAQIERNV
Download sequence
Identical sequences F6ZMG8
ENSOANP00000017265 ENSOANP00000017265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]