SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017415 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017415
Domain Number 1 Region: 1077-1121
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0000000000000636
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0002
Further Details:      
 
Domain Number 2 Region: 171-271
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000275
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017415   Gene: ENSOANG00000010990   Transcript: ENSOANT00000017418
Sequence length 1121
Comment pep:known_by_projection supercontig:OANA5:Contig20780:393:11194:1 gene:ENSOANG00000010990 transcript:ENSOANT00000017418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVPAELWEPFYTDQYAQEHMKPPVTRLLLSAELYCRAWRHALPKMEAPPDPPALLALLA
RRGLTPALPERPVREADLRHQPILMGAHLAVIDALMTAFAIEWTRPLAEPTAPGGWEHKI
LLWVDTTVRRLQETSEREAAQRPSGPVPDGPAQPSIRYRKDRAVARRAPCFPVVSGLQDL
ASGAALAATIHYYCPQLLRLEDVCLKDTMSVADSLYNLQLLQDFCAARLAGGCPLALEDL
LYVPPILKINIGVLLAELFFCFEVLKPDFVRPKELPDGQGSPRLGDTATPPSGSGSSSPV
FNFRHPLLSPGGPQSPLRGSAGSLHHSPSLSHVEGFGKTWNRQLSRPLSQAISFSIPFGL
DSDVDIVMGNPVLLRSASSDSLGPPSRAPAFAPPAPRPPPHPVEPAPEPGDLPTIEEALQ
IIHSAEPRLLPDGAADGAFYLHSPEGSPRPPPEGPSKSGSLPAYHPHPEGSPKSSPAATY
PPEASPKAPPATSPARGPPAMAPEGPVRMTSFAERKKHLLKPEGRAEEEAAMAAGVGAAG
PETLTSEMSSEMSQLGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQRREAGED
GPEDGPVDGPEEGPEGREGERPAGEDRGEALERPPERAKTVTFGPEVGRPAEENLGDYNR
AVNKLSAALSSLQRDMQRLTAQQQRLMGDKPPPPPPPGPAAWVIPAPAAPARPLSPSPAR
RAAPPPRSPQPGPRRATPPAAAPAAPKSPKHARPVELKLLPPLTRVLTPPNNVDTLPHLR
KFSPSQVPVQTRSSILFDEGDGAPGARPEPGGDPPGNPRRSTLIEIPLGSLQPEGGDEDG
SPPGDDSLEEAAEAEQRAGLGFFYKDKEKPEDEMAQKRASLLERQQRRADEAKRRKQWLE
AEKEQKKEAAARAPHFFPAVGPPPPVTPPLPPVGRLAQEERGRVEEESGARRGDFTRQEY
ERRAQLKLMEDLDKVLRPRAAGPGRGRRAARPRSGCCDDSALGRSPARGLLGSRLSKVYS
QSTLSLSTVANESANSLAVKRSSRAPSPSGLMSPSRLLGSREKDWENGSTASSPASVPEY
TGPKLYKEPSAKSNKYIIHNALSHCCLAGKVNEPHKNRILE
Download sequence
Identical sequences F7DHE5
ENSOANP00000017415 ENSOANP00000017415 9258.ENSOANP00000017415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]