SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017451 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017451
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-81
Family Calponin-homology domain, CH-domain 0.0000994
Further Details:      
 
Domain Number 2 Region: 1038-1151
Classification Level Classification E-value
Superfamily E set domains 6.37e-38
Family Filamin repeat (rod domain) 0.00000381
Further Details:      
 
Domain Number 3 Region: 1326-1438
Classification Level Classification E-value
Superfamily E set domains 8.67e-36
Family Filamin repeat (rod domain) 0.0000232
Further Details:      
 
Domain Number 4 Region: 1527-1635
Classification Level Classification E-value
Superfamily E set domains 2.54e-33
Family Filamin repeat (rod domain) 0.00000503
Further Details:      
 
Domain Number 5 Region: 1419-1537
Classification Level Classification E-value
Superfamily E set domains 2.8e-32
Family Filamin repeat (rod domain) 0.0000298
Further Details:      
 
Domain Number 6 Region: 454-567
Classification Level Classification E-value
Superfamily E set domains 5.34e-31
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 7 Region: 2036-2131
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.000016
Further Details:      
 
Domain Number 8 Region: 666-773
Classification Level Classification E-value
Superfamily E set domains 2.87e-30
Family Filamin repeat (rod domain) 0.0003
Further Details:      
 
Domain Number 9 Region: 844-964
Classification Level Classification E-value
Superfamily E set domains 8.92e-30
Family Filamin repeat (rod domain) 0.00037
Further Details:      
 
Domain Number 10 Region: 1853-1948
Classification Level Classification E-value
Superfamily E set domains 1.67e-29
Family Filamin repeat (rod domain) 0.00000728
Further Details:      
 
Domain Number 11 Region: 1141-1247
Classification Level Classification E-value
Superfamily E set domains 2.14e-29
Family Filamin repeat (rod domain) 0.0000354
Further Details:      
 
Domain Number 12 Region: 1237-1348
Classification Level Classification E-value
Superfamily E set domains 2.6e-29
Family Filamin repeat (rod domain) 0.0000153
Further Details:      
 
Domain Number 13 Region: 2229-2322
Classification Level Classification E-value
Superfamily E set domains 7.34e-28
Family Filamin repeat (rod domain) 0.00000507
Further Details:      
 
Domain Number 14 Region: 373-473
Classification Level Classification E-value
Superfamily E set domains 2.67e-26
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 15 Region: 558-658
Classification Level Classification E-value
Superfamily E set domains 3.4e-26
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 
Domain Number 16 Region: 2420-2512
Classification Level Classification E-value
Superfamily E set domains 5.27e-26
Family Filamin repeat (rod domain) 0.0000111
Further Details:      
 
Domain Number 17 Region: 1624-1737
Classification Level Classification E-value
Superfamily E set domains 5.4e-26
Family Filamin repeat (rod domain) 0.0000508
Further Details:      
 
Domain Number 18 Region: 2548-2639
Classification Level Classification E-value
Superfamily E set domains 4.6e-25
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 19 Region: 273-370
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.00098
Further Details:      
 
Domain Number 20 Region: 2327-2418
Classification Level Classification E-value
Superfamily E set domains 5e-24
Family Filamin repeat (rod domain) 0.0000137
Further Details:      
 
Domain Number 21 Region: 762-863
Classification Level Classification E-value
Superfamily E set domains 4.06e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 22 Region: 2149-2242
Classification Level Classification E-value
Superfamily E set domains 2.14e-21
Family Filamin repeat (rod domain) 0.0000153
Further Details:      
 
Domain Number 23 Region: 952-1058
Classification Level Classification E-value
Superfamily E set domains 1.05e-20
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 24 Region: 1954-2051
Classification Level Classification E-value
Superfamily E set domains 1.8e-18
Family Filamin repeat (rod domain) 0.0000841
Further Details:      
 
Domain Number 25 Region: 1791-1868
Classification Level Classification E-value
Superfamily E set domains 4.54e-17
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017451   Gene: ENSOANG00000011016   Transcript: ENSOANT00000017454
Sequence length 2640
Comment pep:known_by_projection ultracontig:OANA5:Ultra401:24064:78800:-1 gene:ENSOANG00000011016 transcript:ENSOANT00000017454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRHNQSGAAVGDKEAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIAN
LQTDLSDGLRLIALLEVLSQKKMYRKYNQRPTFRQMQLENVSVALEFLDRESIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEETKKQTPKQRLLGWIQNKLPQLPIT
NFSKDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPSGNMVKKRAEFTV
ETISAGQGEVLVYVEDPAGHREEAKVIANNDKNRTFSVWYIPKVTGTHKVTVLFAGQHIA
KSPFEVNVDKSHGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGVGEVEVVIQDPTGK
KGTVEQQLEDKGNSTYRCTYKPTLEGTYTIYITFAGVPIPRSPYTVTIGQACNPNACRAV
GRGLQPKGVRVKETADFKVYTKGAGSGELKVVVKGPKGEERVKQKDLGDGVYAFEYYPTA
PGNYIVTITWGGQNISRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDV
GTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNNEDIKLSPFMAEIKTA
PKDFYPEKVKARGPGLEKTGVAINKPAEFTVDAKNGGKAPLKVQVQDSEGSPVEVSVKDN
GNGTYNCSYVPKKPVKHTAMVSWGGVNIPNSPYRVNVGAGSHPNKVKVYGPGVAKTGLKA
HEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSY
TIMVLFADQATPTSPIRIKVDPSHDASKVKAEGPGLNRSGVELGKPTHFNVNAKPAGKAK
LDVQFTGPAKGDAVQDVDVIDHHDNTYTVKYTPVQQGNMGVNVTYGGDHIPKSPFSVGVA
QTLDLNKIKVSGLGEKVEVGKDQEFTVKSKGAGGQGKVGAKIIGPSNKSVPCKVEPGLSA
DNSVVKFIPREEGPYEVEVTYDGVPVPGSPFPVEAVPPTNPSKVKAYGPGLKGGSAGSPA
PFTIDTKGAGNGGLGLTVEGPCEAKIECLDNGDGTCSVSYLPTEPGEYSINILFADSHIP
GSPFKAQIAPCFDPSKVKCSGPGLEHATVGEAGQFHVDCSSAGSAELTIEIISDTGMQAE
VRIQDNGDGTYTITYIPLYPGVYTITIKYGGQMVPDFPSKLKVEPAVNTAGVKCYGPGVE
GKGVFREATTEFNVDARALTKAGGPHIKTRVSNPSGNLTDTYVQDNGDGTYKVEYTPYEE
GVHSVDVTYDGSPVPSSPFHVPVTEGCDPARVRVHGPGIQSGTTNKPNKFTVETRGAGTG
GLGLAVEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYSLNVTYGGHQVPGSPFKVPVHDVI
DSSKVKCSGPGLSPGVVRANVPQSFQVDTSKAGVAPLQVKVQGPKGVVEPVDVVDNADGT
QTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPV
EFTIDAKDAGEGLLAVQITDPEGKPKKTTIRDNQDGTYTVSYVPDMTGRYTILIKYGGDE
IPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDAKAAGKGKVTC
TVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVMALDGDQP
AAQQMMPQQLAPPYPYPPGMQQPWATDRPLMGVNGLDVAGLRPFDLVIPFTIKKGEITGE
VRMPSGKVAKPDITDNKDGTVTVRYAPTEAGLHEMDIRYDNMHIPGSPLQFYVDYVNSGH
VTAYGPGLIHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKADIGCTDNQDGTCTVSYLPV
LPGDYNILVKYNDKHIPGSPFTAKITGDDSIRMSHLKVGSAADIPLNITETDISQLTATV
IPPSGREEPCLLKRLRNGHVGISFVPKEIGEHIVNIKKNGHHIPNSPITVTISQSEIGDA
SRVRVSGPGLSEGRTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCKVTYC
PTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESISRKQRAPSVANVGSHCDLSLKIP
EINIRDMTAQVTSPSGKTHEAEIMEGENNTYCIRFVPTEMGVHTVNVKYKGQHVPGSPFQ
FTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFED
RKDGSCGVSYIVQEPGDYEVSVKFNDDHIPDSPFVVPVASPSDDARRLTVSSLQESGLKV
NQPASFAVSLNGAKGVIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFN
GSHIPGSPFKIRVGEPGQGGDPGMVSAYGAGLEGGITGSPAEFIVNTTGAGAGALSVTID
GPSKVKMDCQECSEGYKVTYTPMAPGSYLISIKYGGPYHIVGSPFKAKVTGPRLVSSHSL
HETSSVFVDSVTKADAVLQQGAPPKFHSDASKVVAKGLGLNKAFVGQKNSFTVDCSKAGN
NMLLVGVHGPKTPCEEILVKHLGNRLYNVTYLLKDKGDYTLVVKWGEDHIPGSPFHLTVP
Download sequence
Identical sequences F7D6Q6
9258.ENSOANP00000017451 ENSOANP00000017451 ENSOANP00000017451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]