SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017724 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017724
Domain Number 1 Region: 90-392,432-486,529-584
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-66
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 2062-2162
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000252
Family Motor proteins 0.024
Further Details:      
 
Domain Number 3 Region: 1392-1477
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000531
Family Motor proteins 0.03
Further Details:      
 
Domain Number 4 Region: 583-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000584
Family Motor proteins 0.032
Further Details:      
 
Domain Number 5 Region: 1772-1842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000106
Family Motor proteins 0.028
Further Details:      
 
Domain Number 6 Region: 1337-1413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000112
Family Motor proteins 0.029
Further Details:      
 
Domain Number 7 Region: 1189-1265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000135
Family Motor proteins 0.044
Further Details:      
 
Domain Number 8 Region: 839-936
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000159
Family Motor proteins 0.062
Further Details:      
 
Domain Number 9 Region: 1114-1191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000478
Family Motor proteins 0.019
Further Details:      
 
Domain Number 10 Region: 1261-1334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000175
Family Motor proteins 0.051
Further Details:      
 
Domain Number 11 Region: 1554-1622
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000244
Family Motor proteins 0.024
Further Details:      
 
Domain Number 12 Region: 1699-1770
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000292
Family Motor proteins 0.054
Further Details:      
 
Domain Number 13 Region: 1014-1112
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000531
Family Motor proteins 0.045
Further Details:      
 
Domain Number 14 Region: 1841-1906
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000531
Family Motor proteins 0.023
Further Details:      
 
Domain Number 15 Region: 1626-1692
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000664
Family Motor proteins 0.044
Further Details:      
 
Domain Number 16 Region: 2437-2533
Classification Level Classification E-value
Superfamily ARM repeat 0.00000864
Family Armadillo repeat 0.039
Further Details:      
 
Domain Number 17 Region: 1907-1980
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.063
Further Details:      
 
Domain Number 18 Region: 1477-1546
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000345
Family Motor proteins 0.073
Further Details:      
 
Domain Number 19 Region: 1983-2066
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000943
Family Motor proteins 0.044
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000017724
Domain Number - Region: 930-1030
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000191
Family Motor proteins 0.033
Further Details:      
 
Domain Number - Region: 2298-2407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000797
Family Motor proteins 0.075
Further Details:      
 
Domain Number - Region: 2154-2237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00248
Family Extended AAA-ATPase domain 0.069
Further Details:      
 
Domain Number - Region: 743-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.022
Family Extended AAA-ATPase domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017724   Gene: ENSOANG00000011184   Transcript: ENSOANT00000017727
Sequence length 2655
Comment pep:novel chromosome:OANA5:4:47465566:47502240:1 gene:ENSOANG00000011184 transcript:ENSOANT00000017727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPRHPMPFAAKNMFYDERWMEKQEKGFLWWLNFILTPDDLTVKTNTSQVNAATLLLGLEN
HHKVCVPKAPTKDEMSLRAYTARCRLNRLRRAACRLFTSELMVKAIKKLEVEIEARRLLV
RKDRHLWKDIGERQKVLNWLLSYNPLWLRIGLETVFGELISLEDNSDVAGLAVFILNRLL
WNPDIAADFRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDRAKLTRLIDHDPCLFCKD
AAFKSSKEILLAFSRDFLSGEGDLSRHLGFLGLPVSHTQTPLDEFEFAVTNLAVDLQCGV
RLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKERRVQLNDERGTAIQCKDI
VDRHRERTLALLWKIAFTFQVEISLNVKEITEEIEFLKRAWNMKKKMAALSSHIDVPDNI
KRHSRSSFSAEQYSENVKLLMTWVNAVCAFYGIKVENFTVSFSDGRVLCHLIHQYHPCYV
PLEAICQRTTQTVECTQSGSVALNSSTDTDSSLEMWPGSFEQETTSELFKELLDNEKKNF
QLVNTAVRNLGGIPAMIHHSDMSNTIPDEKVVITYLSFLCARLLELRKETRAARLIQAAW
RKYQLRVYQKLYQEKEKAAVTIQRAVINFLTRQRIKKQITAAVVIQKHWRRYLAQRKSNM
LRKAKLEKIQREAATIIQAYWRRYSSRRGFLKLKHYTTILQAKTRMIIALAAFKRQLWAI
VTIQRHWRANLRRNEDQQRYRKLTSSSLVIQSAYRKWKRHKMERQTKATIVLQRAFREWR
SREQARREKAAIVIQSWYRMQKDLRNYNHVKLCIILIQSRFRCIQAKRSYEAKRRCILTI
QRYYRTYRKGKIARANYLQKRRAVIHLQAAFRGMKARRLYRRIKAALVLQSFWRMRQDRL
KFLHVKKCVIILQSQIRKHKQLQNYKRMKRAACTIQTRFRAWIAGRNALSSYRRVRSAAV
VLQSAYRRMQARKRVHLIRSAVKIQSVYRAYISRKGFLNLKEATIKMQALIKMKQAHRRY
CALREATLYVQRRYRSNKIAVHCREEYERLREACIKVQAFVRGSLVRRQLELQRKAVILL
QSYFRMRKERQNYLRIYRATVFIQNYYRAYRKQIYQRKTFIRVKKAVICLQAAYKGFKVR
QVLKNKREAALKIQTAFRGHIKRRKYQAMLKSSVKIQRWYRACTTRRDVRTNFLRTREAV
LVLQAVYRGWKVRRQIRRERDAAIRIQSVFRRFRAQRQFRLTKNAAVTIQRHFRARTVGR
QWHREYIQLRRAASRLQAVWKGRAVRNHIQRQNQAALIIQSYYRMHVCRKRLKTVREATL
LIQAYYRAYVTGKRQYDQYLKTKVATLVLQSAYRGSRVRKQVKELKKAAVTIQANYKSYK
MKTKYATLRASAVSIQRWYRANRLRQDYLRLKSSVVKVQAVYRGLKVRRRVQRMHEAATR
IQSVFKMHRLKIRYQAMRMAALVIQVRYRAFRQGKRQRDEYRNLRRSAVILQAAFRGARV
RQKLRTMRAAATVIQSHYRKYKQRTYFLKLCLFTKRIQQRYRAGKERDIQVHRYSVLKRS
TVHLQAAFRGMRTRRHLKAMHSAATLIQVRFRAFVVRKSYLSLRRAAILVQRKYRAAAVA
KSHLRDYLCIRKAVITIQASYRGFVVRKRLQKAQRAATLIQATFRMHRSYIPYQAMKLAS
VIIQQRYRACREGRFQRAVYLKQRNSAVVIQSAYRGMRARQALEERHRAAVKIQSSYRRY
RQYRLFRKVRWATEVIQKRYRANREREKAVERYCAMKKAAVCIQAAFRGLKIRKLCRKQR
LAAVLIQRHFRCFMVRKRYLSLKTAAVVCQRRYRAMITAKKLTRAVICIQSTYRGFQVRK
AVQQKHQAATIIQSAFRMYRVRIAYRAMRWAAFVLQNYYRSKARVKIERSKFLALRKATL
TLQAAYRGMKVRQELRSVSERKAAAIVIQAAYRRYQTRTRFQAVRRAALIIQRWYKACRV
THIHRAAFCVQRRAAVTIQSAFRKMLARRIEKRKRAAQRIQVFFKMVVCRRKFLRLRTAA
IVIQKCFRMWRERRWYETRRKAALALQHHYRAHLAVKQQRKVYLQTRNHVVTVQAEVRKF
LHQRRFQKIKVSTVKIQALWRGFKARQLFCQMRAARKIQAWFRCCRAHKEYQAMRRAVHV
IQGCVRTRLQRAWFLKMRASTVVIQRRWRAKVSARITYERFLITKKHQAAALIQASYRGY
IMRRNFLQQKAAAVIIQKHIQARKAGRHERAKYIKMKEAAVVLQAVSRGWLVRKRIVEQK
RQRRLLHFTAAAYHHLSALKIQRAYRIHRALRQAQTQISSVIFIQRWFRARLQRKRFIQD
RQKIIKVQNAVRTWLSRRNRAATVLQRAARRFLFSKREEKLKNRVVKIQALWRGYFWRKN
NDSTKIRALRQRLKKVNEESREENKLYKRTALAIDYLLKYKHLSYILEALKHLEVATRLS
PLCCENMAQSGTISKIFILILSCNRSVPCMEVIRYALQVLLNVAKYEKTTDAVYEVENCI
DTLLELLQMYREKAGDKVADKGGSIFTKTCCLLALLLKVSKRAAEVRSRPKVVDRIHSLY
KLTAHKHKMDAKRTLSKQKMNSSTNGSFFIPVTPIRTKVVSRLKPDWVLRKDNTREIVNP
LQAILMVMDTLGIAH
Download sequence
Identical sequences F7FRE3
ENSOANP00000017724 9258.ENSOANP00000017724 ENSOANP00000017724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]