SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017884 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017884
Domain Number 1 Region: 86-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-34
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 2070-2203
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000111
Family Extended AAA-ATPase domain 0.085
Further Details:      
 
Domain Number 3 Region: 2097-2132,2210-2326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000415
Family Nitrogenase iron protein-like 0.083
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000017884
Domain Number - Region: 1633-1708
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 1885-1927
Classification Level Classification E-value
Superfamily BLRF2-like 0.0471
Family BLRF2-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017884   Gene: ENSOANG00000011288   Transcript: ENSOANT00000017887
Sequence length 2433
Comment pep:known_by_projection chromosome:OANA5:3:6144943:6509926:-1 gene:ENSOANG00000011288 transcript:ENSOANT00000017887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAILVASKMKSGLPKPVHSAAPILHVPMARAGPQPCYLKFGNKVEVTKPVYSSQIPLKS
QGLHEPGGEGLAPKKTSSVENGFDTQIYTDWANHYLAKSGHKHLIKDLQQDVTDGVLLAE
IIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGL
FFSLSRYKQQQQQPQKQPLQHPSSQPTPAVCQQASSLYQCQFGVQQPQQQVQATPQTQCQ
PSQPALHQQLKAQPEMQSRLPGPTARVSAAGSEAKTRGSISTNNRRSQSFNNYDKSKPVT
SPTPPPPPPPPPPSSNSFSSPPGMNENAPISFQSSSSTNSIGGGSSSAIPQPGTAPKPWR
SKSLSAKHTATSSMLSVKQPMSESPKPSPETIKATSNNQKSMLEKLKLFNSKGGSKTGES
LGSRDPSCERLDTLPSFEESEEMEAAQRTTSATGPASNSPKIALKGIAQRTFSRALTNKK
TSPKGNEKDKDKQREKEKEKSKDVSKRASVTEKPDIKEEPKEEPTTAAITEMPKKSSKIA
SFIPKGGKLNSAKKEAPAPSHSGIPKPGMKTTPGKSSSAPASCKEGEKIRSGKPSSGLSH
QKSQLGSKHSSSSSSLASSEGKGIAGSATLSSSSSSQPVNGPASTTQTTGSNTVSVQLPQ
PQQQYNHPNTATVAPFMYRSQADNEGNITAESSTVGMNLEPVIYTKSGQSGLEDLPGEDP
ETRRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEISGRSILSLTGRAT
PLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTESGRYVYSAPLRRQLASRGSNVC
HVDIADKGGEDIDLEGISMDATGYMSDGDVLGKNIRTDDITSGYMTDGGLGLYTRRLNRL
PDGMAVVRETLQRNTTLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYANTP
ASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDES
DKSTSGRKNTVISQTGSWRRGMTAQVGITTPRTKPSTTSGTLKTPGTGKTDDAKVSEKGR
LSPKGTHVKRSPSDAGRSSGDESKKPPSNNSRVTAANTNTFGFKKQSGSSSVGLTMITAS
GAAITSRSATLGKIPKSSGLMGRSTGRKASIDGSPNPDDGYLAMSARTNLQYRSLPRPSK
SSSRNGAGNRSSTSSIDSNISSKSACLPGPKLREPSKTALGSSLPGLVNQTDKEKGISSD
SESVASCNSVKVNPAAQAVSSIAQATHQQGTKYPDVASPTLRRLFGGKPAKQVPVTTAES
MKNSVVISNPHATMNQQGNLDSPSGSGILSSGSSSPLYSKTMDLNQSPLASSPSSAHSAP
SNSLTWGTNASSSSAVSKDGLSYQAVGSLHTSCESIDISLSSGGGVSHNSSTGLIASSKD
DSLAPFVRTNSVKTTLSESPLSSPAASPKFCRNTLPRKQDSDPHLDRNTLPKKGLRYAPS
PQLRTHDDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSPSGTRFNFSQLASPTTATQMSL
SNPTMLRTHSLSNADGPYDPYSDSRFRNSSMSLDEKSRTMSRSGSFRDGFEEVHGSSLSL
VSSTSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIR
LQSLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTSQSADLRI
RRQHSSDSVSSINSATSHSSVGSNMESDSKKKKRKNWYFQLRSSFKQAFGKKKSPKSASS
HSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRTSHSNSLISECTDSEAETVMQLRNELRDK
EMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSENQGSCSRAPSQASIS
SSPRQSLGLSEHSLNLTESTSLDMLLDDTGDSSARKEGGRHVKIVVSFQDEMKWKEDSRP
HLFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNT
AETPELLPCGYLVGENNTISVAVKGLSENSLDCLVFESLIPKPILQRYISLLMEHRRIIL
SGPSGTGKTYLANRLSEYMVLREGRELADGVIATFNVDHKSSKELRQYLSNLADQCNSEN
NAVDMPLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRW
VLCANHTEPVKGFLGRFLRRKLIETEISGRVRNAELVKIIDWIPKVWQHLNHFLEAHSSS
DVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVM
DTYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQIPPSDAEGDPLMNMLMRLQ
EAANYSSPQSYDSDSNSNSHHDDILDSSLESTL
Download sequence
Identical sequences F7DFQ5
9258.ENSOANP00000017884 ENSOANP00000017884 ENSOANP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]