SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018131 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018131
Domain Number 1 Region: 2-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.59e-79
Family Calponin-homology domain, CH-domain 0.0000923
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 4.07e-36
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 3 Region: 1495-1611
Classification Level Classification E-value
Superfamily E set domains 7.01e-35
Family Filamin repeat (rod domain) 0.00000341
Further Details:      
 
Domain Number 4 Region: 1419-1528
Classification Level Classification E-value
Superfamily E set domains 1.54e-32
Family Filamin repeat (rod domain) 0.0000178
Further Details:      
 
Domain Number 5 Region: 1814-1909
Classification Level Classification E-value
Superfamily E set domains 5.8e-31
Family Filamin repeat (rod domain) 0.00000366
Further Details:      
 
Domain Number 6 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 3.2e-30
Family Filamin repeat (rod domain) 0.0000143
Further Details:      
 
Domain Number 7 Region: 1120-1226
Classification Level Classification E-value
Superfamily E set domains 6.67e-30
Family Filamin repeat (rod domain) 0.000041
Further Details:      
 
Domain Number 8 Region: 455-565
Classification Level Classification E-value
Superfamily E set domains 1.4e-29
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 9 Region: 1038-1129
Classification Level Classification E-value
Superfamily E set domains 1.6e-29
Family Filamin repeat (rod domain) 0.00000799
Further Details:      
 
Domain Number 10 Region: 1998-2092
Classification Level Classification E-value
Superfamily E set domains 2.01e-29
Family Filamin repeat (rod domain) 0.0000194
Further Details:      
 
Domain Number 11 Region: 1602-1704
Classification Level Classification E-value
Superfamily E set domains 4.47e-29
Family Filamin repeat (rod domain) 0.0000682
Further Details:      
 
Domain Number 12 Region: 643-740
Classification Level Classification E-value
Superfamily E set domains 1.13e-28
Family Filamin repeat (rod domain) 0.0004
Further Details:      
 
Domain Number 13 Region: 730-844
Classification Level Classification E-value
Superfamily E set domains 8.01e-28
Family Filamin repeat (rod domain) 0.00072
Further Details:      
 
Domain Number 14 Region: 833-944
Classification Level Classification E-value
Superfamily E set domains 2.47e-27
Family Filamin repeat (rod domain) 0.00052
Further Details:      
 
Domain Number 15 Region: 253-349
Classification Level Classification E-value
Superfamily E set domains 2.07e-25
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 16 Region: 2386-2478
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 17 Region: 2191-2286
Classification Level Classification E-value
Superfamily E set domains 8.01e-24
Family Filamin repeat (rod domain) 0.00000711
Further Details:      
 
Domain Number 18 Region: 2293-2383
Classification Level Classification E-value
Superfamily E set domains 2.74e-23
Family Filamin repeat (rod domain) 0.00000468
Further Details:      
 
Domain Number 19 Region: 931-1032
Classification Level Classification E-value
Superfamily E set domains 5.27e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 20 Region: 2108-2204
Classification Level Classification E-value
Superfamily E set domains 3.14e-21
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 
Domain Number 21 Region: 1917-2013
Classification Level Classification E-value
Superfamily E set domains 3.6e-18
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 22 Region: 1751-1831
Classification Level Classification E-value
Superfamily E set domains 2.6e-16
Family Filamin repeat (rod domain) 0.0000511
Further Details:      
 
Domain Number 23 Region: 343-422
Classification Level Classification E-value
Superfamily E set domains 0.000000000661
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 24 Region: 542-610
Classification Level Classification E-value
Superfamily E set domains 0.0000000012
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000018131
Domain Number - Region: 2515-2547
Classification Level Classification E-value
Superfamily E set domains 0.000841
Family Filamin repeat (rod domain) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018131   Gene: ENSOANG00000011443   Transcript: ENSOANT00000018134
Sequence length 2547
Comment pep:known_by_projection chromosome:OANA5:10:4016207:4056585:1 gene:ENSOANG00000011443 transcript:ENSOANT00000018134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLGDLQRDLSDGLRLIALLEVLSQK
RMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAP
GLCPNWETWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKA
KLKPGAPVRSKQLNPKKATAYGPGIEPHGNTVLQPAHFTVQTVDAGLGEVLVYIEDPEGH
TEEAKVVPNNDKDRTFAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSA
RGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGPAGHHCSVGVALEDKGDNTAS
ILWGEKHSRPADGESAGVGEAKKEGRPGVGFTRACNPNACRAAGRGLQPKGVRVKEVADF
KVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTISWGGYAIP
RSPFEVQVSPEAGTQKVRAWGPGLETGQVGKSADFVVEAVGTEVGTLGKMLKGAPIDIKV
QPNGDGTFPFAPYVPTRSAVNGIYDDSPAVSQAPHEGIPQTWGNSKKVKAFGPGLEPTGC
IVDKPAEFTIDARAAGKGDLKLYAQDAEGCPIDIKVQPNGDGTFRCSYVPTKPIKHTIIV
TWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIG
IKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGHYTIMVLFANQEIPASPFHIKVD
PSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVSFAGAAKGEAVRDFEIID
NHDYSYTVKYTALQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKVKVQGLNSKVAVGQ
EQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITY
DGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGKPAPFSIDTKGAGTGGLGLTVEGP
CEAKIECQDNGDGSCAVSYLPTEPGEYSINILFAEAHIPGSPFKADIRPVFDPSKVRASG
PGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPG
TYTITIKYGGHPVPKFPARVRVHPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTA
TGGNHVTARVLNPSGAKTDTYITDNGDGTYRVQYTAYEEGVHLVEVLYDDVAVPKSPFRV
GVTEGCDPTRVRAYGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKD
GSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVP
QTFTVDCSKAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTANYTPATDGPYTVAVKYADQ
EVPRSPFKIKVLPAHDASKVRASGPGLNAAGIPASLPVEFTIDARDAGEGLLTVQILDPE
GKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVT
GACLGPRIQIGEETVITVDAKAAGKGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPE
PGKYVITIRFGGEHIPNSPFHVLVSLGTRAAALFSPTELPPAANSFATEEPVAPAEPLES
MLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTITVRYAPSEKGLHEMGIKY
DGNHIPGSPLQFYVDAINSRQVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPS
KAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVG
TSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKS
GKHVTNSPFKIFVGPSEIGDASKVRVWGKGLSEGHTFQVSEFIVDTRTAGYGGLGLSIEG
PSKVDINCEDMEDGTCKVTYCPTEPGNYIINIKFADKHVPGSPFTVKVTGEGRMKESITR
RRQAPSIATIGSTCDLNLKIPGETGSQDMTAQVTSPSGKTEEAEILEGEDSAYSVRFVPQ
EMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPGRPTAEFSI
WTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPF
VVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVS
ELDSDKHTIRFIPHENGVHSIDVKFNGSHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEG
GTTGVSSEFIVNTVNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGSYLIAIKY
GGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASK
VVTRGPGLAKAFVGQKNSFTVDCSKAG
Download sequence
Identical sequences F7A4L1
9258.ENSOANP00000018131 ENSOANP00000018131 ENSOANP00000018131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]