SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018488 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018488
Domain Number 1 Region: 233-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-49
Family DBL homology domain (DH-domain) 0.0000000913
Further Details:      
 
Domain Number 2 Region: 423-546
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-36
Family Pleckstrin-homology domain (PH domain) 0.00000451
Further Details:      
 
Domain Number 3 Region: 1-116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-27
Family Calponin-homology domain, CH-domain 0.00061
Further Details:      
 
Domain Number 4 Region: 161-226
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-24
Family SH3-domain 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018488   Gene: ENSOANG00000011671   Transcript: ENSOANT00000018491
Sequence length 774
Comment pep:known_by_projection chromosome:OANA5:6:7401214:7490065:1 gene:ENSOANG00000011671 transcript:ENSOANT00000018491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEERIVTWLISLGVLNSPKKTISDPEEFLKCSLKNGVVLCKLINRLVPGSVEKYCQEP
KTEADCTSNIKEFLKGCASLQIEVFDANDLYSGVNFSKVLSTLLAVNKATEDKPSEKPCR
RSSSLSAPSSQTYLKRVSSNTGSVLRRQSKAVEMTENGSHQLVVKARFNFKQTNEDELSV
SKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSTEKPLSPKTLKGGETLQLTKNY
YTVVLQSILETERDYAKELQSLLGTYLRPLQSNDKLSPVEFTSLLGNFEEIGTFQQTLCQ
TLEECAKVPENQQKVGGCLMNLMPQFKSLYLTYCANHPSAVNVLTQHSDDLEKFMETQGA
ANPGILILTTSLSKPFMRLEKYVTLLQELERHMEEAHPDHQDILKAVTSFKALVAQCQEL
RKRKQLELQILSESIQGWEGEDIKTMGNVIFMSQVMVQCGASEEKEERYFMLFSNVLLML
SASPRMSGFIYQGKLPVTGMTLTRLDENEGNDYTFEITGTMIDRIIVSCNNGQDLQEWTD
HLHRLTRGPGPGPTLTKAQSWSAHSSFSYAGQTRGPLEPPQILKPWSLSCLRPAPPLRPS
AALGYKERMSYILKDSSKSPKTMKKFLHKRKTERKASSEDEFAIRKSTAALEEDAQILKV
IEAYCTGAGFQQTSKTGSRKDSIPQVLLPEEEKIIVEETRSNGQTVTEEKSLVDTVYALK
DEVKELKQENKRMKQCLEEELKSRKDLEKLVRRLLKQTDECVRDESSRRSSILA
Download sequence
Identical sequences F6RAI2
ENSOANP00000018488 9258.ENSOANP00000018488 ENSOANP00000018488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]