SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019056 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019056
Domain Number 1 Region: 1-123,157-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-75
Family Calponin-homology domain, CH-domain 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019056   Gene: ENSOANG00000012033   Transcript: ENSOANT00000019059
Sequence length 913
Comment pep:known_by_projection ultracontig:OANA5:Ultra378:1543920:1664590:-1 gene:ENSOANG00000012033 transcript:ENSOANT00000019059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERENVQKRTFTRWINLHLEKCKPPLEVKDLFLDIQDGKVLMALLEILSGQKLLHEYKSSS
HRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNSSLVLGLIWNIILFFQIKELTGNLN
RNSSSSSLSSGLGGTDSDSSHPTTPSTEKNVAVSVKDQRRAIRALLAWVQKRTRKYGVAV
QDFAASWRSGLAFLAVIKAIDPTLVDMKQALEDSARENLERAFSVAQDRLHIPRLLEPED
VMVDTPDEQSVMTYVAQFLEHFPELEGEDVPDPDKEFPIESTFVHIKETPVEQEGKIFVL
NENGQRAYTINHETSQPPPPKVFVCDAPDSSNFEISHVSDNSNNQTSPFTDQFIPGCSKK
SADFNQSLSEPSVLLPKKEIQRPNSLPIMSSDHFESDTCEQVLENKLAPNKWNESSLNEP
LEQKSCLSPTVVTDEKNTILPADSFEVDSEQLKDEKHAVERARYSEGNSEHLASEASPES
SDNVDTTANKVLDDPLSASVKKAIVIPDSLEDNVKQLERTGSLEQVEIIDLTGSNITPDD
FPSTYGERSTVANSSENDADELVRKGSKSISEATGSTSISPCDNGPPGTAFITSDTPSIE
PPNPGLEQGERIQQESAGQTKRECGGVEDAGPEGSGASPRDREDNISISSQSVVSLKDIH
VQESQQGDGADLMATSSSKVSVIPHDLFYYPHYNVPISAVLEAFADSSSSPDGSKSGGTL
PETSGTVREGEEEQAARPVLANYSYQNAFICSFVHPSDFMDTSLPEHPTSISGLSGSGYE
DGESGGLPVVKREGIPDKREGVSERQMFQAIENMDQLEATLETLLGEAISSKKKEKRKHV
EKREMLKIAAATPAYLPDDPEDEITDHKMFSRASHSDSSIYIRRDANKPVDADHFNRKES
RKSDTEERRHLII
Download sequence
Identical sequences F7DN76
ENSOANP00000019056 ENSOANP00000019056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]