SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019209 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019209
Domain Number 1 Region: 75-201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019209   Gene: ENSOANG00000012128   Transcript: ENSOANT00000019212
Sequence length 243
Comment pep:known_by_projection supercontig:OANA5:Contig18458:11778:18585:1 gene:ENSOANG00000012128 transcript:ENSOANT00000019212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SISNKELSELIEQLQRNADQVEKNIVDTDAKMQADLAQIKEGRPAQYRDVAIQKVSDSEK
LLYVLEADAAIAKHMKHPQGDMITEDIRQLKGRVANLREKHNQIYTLTAKEVNPPVNWDS
VVNEKLGSLKGQTFGTDLPLVDQQVEEHNIFHNEVKAIGPHVNKDGDKRRSLLLSSVPAQ
AGSQERQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRN
LES
Download sequence
Identical sequences F7E589
ENSOANP00000019209 ENSOANP00000019209 9258.ENSOANP00000019209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]