SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019403 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019403
Domain Number 1 Region: 28-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.24e-91
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 298-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-34
Family Spectrin repeat 0.000062
Further Details:      
 
Domain Number 3 Region: 421-537
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-20
Family Spectrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019403   Gene: ENSOANG00000012260   Transcript: ENSOANT00000019406
Sequence length 567
Comment pep:known_by_projection supercontig:OANA5:Contig6918:518:26190:-1 gene:ENSOANG00000012260 transcript:ENSOANT00000019406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDVNNRWELPDADWDNENSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLEFDSLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYA
LEAERLVEKYESLASELLQWIEQTILTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYAPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVAQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAEHYHDIKRIAARQHNVARLWDFLRQLVAARRERLLLNLDLQKVFQDL
VYLMDWMEEMKVSGWGLGTRPGPGGWR
Download sequence
Identical sequences F7E4A2
ENSOANP00000019403 ENSOANP00000019403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]