SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019879 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019879
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000535
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019879   Gene: ENSOANG00000012574   Transcript: ENSOANT00000019882
Sequence length 57
Comment pep:novel supercontig:OANA5:Contig268451:346:516:-1 gene:ENSOANG00000012574 transcript:ENSOANT00000019882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLKTELNDTRPKVDSVRDQAANLMAYRGDHCRRVVEPELAQLDRRFAAVAQRIQPEK
Download sequence
Identical sequences F7D920
ENSOANP00000019879 9258.ENSOANP00000019879 ENSOANP00000019879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]