SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020057 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020057
Domain Number 1 Region: 949-1054
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-32
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020057   Gene: ENSOANG00000012676   Transcript: ENSOANT00000020060
Sequence length 1056
Comment pep:known_by_projection ultracontig:OANA5:Ultra69:1106369:1268714:-1 gene:ENSOANG00000012676 transcript:ENSOANT00000020060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAAKPWGTVAKQGSHGTDRGRPLPAASSGMKTSKSSTSLAFESRLSKLKRASSDDMLT
KPGVTTASGVARIKKTATTGAISELAEGRLKSNTGTVSSSKRTGIPAPRELSATISRERA
VLRSSPSTRKSVPSPTSSGTPTPTKHLKSSAKPKQENEAGDKAVLESQIRELLAEAKTKD
FEISKLQSELQKCKELPTADISGGASDQNVDGLAGPLGDMDPLIRALQEKNRTFQKELAS
LGEENRALKEKLIYLEQSPVSETTTSNCGESSLQTPTTQESSFGSPTKSQLPGESDEYQQ
HVNGNSLQTPGSSSSDVTKASLSPDASDFEHIVEAPSRPVSSSSNPFKSSRCSTSGSSPN
NISELSVASLTERIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKALLE
TSFHQQRERAEQLSQENEKLMNLLQERSKNEEARSQDEKVLELEHKCTEILEKAQFEREK
LLNIQQQLTCSLRKVEGENQGALEMIKCLKGENEQLSGFLELERQNTSLTVKSLEECRVD
LEGLKIENGSLRAQLDSEKQKAAEINALGNSADSSEVHEMLRVARAEKDQLELSCTELKQ
ELLKAKSEIKQVQGLLTKVEKECSHLRELSDRQTEQLSRTSLKLQEKASESDAEIKDMKE
TIYELEDQVEQHRAVKLHNNQLISELESSVMKLEEQKLDLERQLKTMSKQIKEETEEWRR
FQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNAKLQRELEEVQGSNRPVNEEAEF
SETDASSRWQGVCVSRASPTPSESAATVKSLIKSFDLGMTAGTGQNIPAHKAPRSPLSGI
PVRTAPAAAVSPMQRHSTYSNAKPASKVIAKLGALPDLPLTDILKGRNEDLKPDHYLRKS
PSLESLSRPASLGFSNTRMLTPTLGGVKPQSKLSVERKDPLAALAREYGGSKRNALLKWC
QKKTEGYPNIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNGQEKKRNLLLAFQAAES
VGIKPSLELSEMMYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences F7B0Q3
ENSOANP00000020057 ENSOANP00000020057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]