SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020437 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020437
Domain Number 1 Region: 465-645
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.36e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0022
Further Details:      
 
Domain Number 2 Region: 623-724
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000020437
Domain Number - Region: 316-379
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0811
Family Rad50 coiled-coil Zn hook 0.0098
Further Details:      
 
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0915
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020437   Gene: ENSOANG00000012922   Transcript: ENSOANT00000020440
Sequence length 728
Comment pep:known_by_projection supercontig:OANA5:Contig3032:1943:36250:1 gene:ENSOANG00000012922 transcript:ENSOANT00000020440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLIFPHLNASAEKARNVLAVETVPGELVGEQAANQPAPVHASIHNFSLKQWGTELKNSM
SSFRPGKGNSDNRKSVFYTSEEWELIDPTPKDMEESILQEERRKQTSEGSKGVTGSTFSF
DFGRIPSKGKRPLKDMIGSYKNRSNHGDSPVEWTPGNSNKLALEMQLKIQNQQEELERLG
KDLSSQKELVRLLQQTVRSSQYDKYFTSSHLCDGIPRDKLELLHQKDDHILGLNSQLEKF
SLEKDSLQQEVRNLKSKIGELNEQLGMLMETIQAKDEVIIKLSRQLSECEGNSSSQSGTP
TTSESPSFKKELQELDRIKDNLQGYKTQNKFLNKEILELSALRRNAERREREMMAKYSSL
EAKLCQIESKYLILLQEMKTPVCSEEQGPARDVIARLLEDALQVDSVEQPEQAFVKPHLV
SEYDIYGFRTVPEDDEEEKLVAKVRALDLKSLYLTENQDISTGVKWENYFASTMNREMMC
SPELKSLIRTGIPHEHRSKMWKWCINLHTKKFKDSTDPGYFQTLLQNALEKQNPASKQIE
LDLLRTLPNNKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAIALLYLEQEDA
FWCLVTIVEVFMPQDYYTKTLLGSQVDQRVFKDLMSEKLPRLHAHFEQYKVDYTLITFNW
FLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYF
TRTILDAR
Download sequence
Identical sequences F7AWJ8
ENSOANP00000020437 9258.ENSOANP00000020437 ENSOANP00000020437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]