SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020578 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020578
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-27
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 3-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 585-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000588
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020578   Gene: ENSOANG00000013015   Transcript: ENSOANT00000020581
Sequence length 633
Comment pep:novel supercontig:OANA5:Contig10070:5366:16400:-1 gene:ENSOANG00000013015 transcript:ENSOANT00000020581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTAFQGLVTFSDVAVSFTREEWEHLDPSQRSLYWDVMLENYGNLASLGICPEEVLFLIND
KQTEVGNSRRRSTDNPEVPTWELKRKITWGEEKFIKINLPEEGWQDQAFGSVTFGPLIFA
PSSAPQHGYVHIYSGIIRADLPRTHGQSLEFYSPSLLQSFPKLPDANRFHSCRHYPELCP
QSKKNVEEVHRKTSREERVCECEKAFKWSPCLIGHQRIHTGEKACPCHECGKTVSQYSDL
SKHRRIRTRGKLYKCSQCGKEFRWSSRLIEHQRIHTGEKPFKCGGCGRAFGRHSDLVKHQ
RIHTGEKPYKCSQCGRAFSQHSDLVKHQRIHTGEKPYKCHECGKAFSQHSTLIEHQRIHT
GEKLYKCNDCGKAFSQHSDLIKHQRIHTGEKPYKCNECGKSFSQHSNLKTHQRIHTGEKP
YNCNTCGKAFSVRSSLISHQRIHTGEKCYQCNECGKAFNQHSDLIKHQRIHTGEKPYKCS
ECGKGFSQHSSLIEHHRIHTGEKPYRCSACGKAFSQHSDLIKHQRIHTGEKPYTCNECGK
AFSQRSNLITHQRIHTREKLCKCNECGKTFSVRPTAVNHRRIYTGEKPYRCNDCDEHFVL
TDQIVHPGRKTYKCSQYQKAFGYNPHLPAHQRM
Download sequence
Identical sequences F6S8Y3
9258.ENSOANP00000020578 ENSOANP00000020578 ENSOANP00000020579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]