SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000021056 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000021056
Domain Number 1 Region: 209-365
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-34
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 315-467
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-31
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 3 Region: 527-682
Classification Level Classification E-value
Superfamily Spectrin repeat 1e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 4 Region: 5-151
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-26
Family Spectrin repeat 0.00000166
Further Details:      
 
Domain Number 5 Region: 686-737
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000072
Family Spectrin repeat 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000021056   Gene: ENSOANG00000013338   Transcript: ENSOANT00000021059
Sequence length 737
Comment pep:novel supercontig:OANA5:Contig5778:29746:46836:1 gene:ENSOANG00000013338 transcript:ENSOANT00000021059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLRQMMQASGVKVLETAEDIQERRQEVLNRYYRFKELVAERGQRLEDSYHFQVFRRDAD
DLEKWLLEKIKTASDESYKDPTNIQSKYQKHQSLEAEVRAKSRILPDLEEIQMSRFTEGH
FAHEETKNHLEELRRLWDLLLDLIKDRGTKLLKVLELLQYLQECADILEWISDKEAIVTS
EELGQDWERAEVLHKKFEEFQTDLATREGRVQEVNHFADKCTQENHPELKLIKTKQDEVN
AGWLRLQGLALQRRETLSDAADFQRFNRDVVEAIQWLKEKEPLVASEDWGSDLVNAEALF
HRHKGLERNLAVMEDKVKELYAKADKLQQSHPSEAPQIQEKKEDLMSNWERVRELATRRH
DRLQDSYRYHRFLADFEELTSWMTEKVALIKADELPTDVAGGQALLDRHQQHKHEIDSYQ
DRFQSAEENGQALLDANHDASDEVREKMAILSGDLSSLMALWEKQWQIYEQCLNLHLFYR
DSEQVDSWMGRQEAFLENEDLGNSLGSVEVLLQKHNDFEEAFDAQEEKITTLDQTATKLI
DKDHYDKENIADIRDKLLARREALRTRALARRGQLEASRLLQQLYQDADDLKGWITKKTK
VAADEDQMDLQNVKSRVQKQQVFEEELRTNQSRLNALEKMGQELIKAEHYAADKVAFRVD
EVSGLWKQLLDTMKLKGTQLQEANQQQQFNHTVEELERWLQDAEGQVASQDYGRGLADVQ
NLLRKHDLLEANVTSRQ
Download sequence
Identical sequences F7E6W8
ENSOANP00000021056 9258.ENSOANP00000021056 ENSOANP00000021056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]