SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000021746 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000021746
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.84e-26
Family CRAL/TRIO domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000021746   Gene: ENSOANG00000013790   Transcript: ENSOANT00000021749
Sequence length 139
Comment pep:known_by_projection ultracontig:OANA5:Ultra293:97511:106497:1 gene:ENSOANG00000013790 transcript:ENSOANT00000021749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTLKRIFLHGNNLNSLHQLIHPEILPSE
FGGMLPPYDMGTWARTLLDHEYDDDSEYNVDPYSMPVKEVEKELSPKSMKRSQSVVDPGM
LKHMDKHEEENLQPLLSLD
Download sequence
Identical sequences F7DV42
ENSOANP00000021746 9258.ENSOANP00000021746 ENSOANP00000021746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]