SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000021837 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000021837
Domain Number 1 Region: 2-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-78
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 7.34e-33
Family Filamin repeat (rod domain) 0.00000547
Further Details:      
 
Domain Number 3 Region: 1592-1706
Classification Level Classification E-value
Superfamily E set domains 3.87e-31
Family Filamin repeat (rod domain) 0.00000549
Further Details:      
 
Domain Number 4 Region: 1494-1611
Classification Level Classification E-value
Superfamily E set domains 1.07e-30
Family Filamin repeat (rod domain) 0.0000246
Further Details:      
 
Domain Number 5 Region: 1419-1527
Classification Level Classification E-value
Superfamily E set domains 3.54e-30
Family Filamin repeat (rod domain) 0.00000727
Further Details:      
 
Domain Number 6 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 2e-29
Family Filamin repeat (rod domain) 0.00000481
Further Details:      
 
Domain Number 7 Region: 1029-1127
Classification Level Classification E-value
Superfamily E set domains 4.07e-29
Family Filamin repeat (rod domain) 0.00000288
Further Details:      
 
Domain Number 8 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 2.34e-28
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 9 Region: 720-844
Classification Level Classification E-value
Superfamily E set domains 4.14e-28
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 10 Region: 1817-1912
Classification Level Classification E-value
Superfamily E set domains 8.01e-28
Family Filamin repeat (rod domain) 0.0000143
Further Details:      
 
Domain Number 11 Region: 341-451
Classification Level Classification E-value
Superfamily E set domains 1.27e-26
Family Filamin repeat (rod domain) 0.00097
Further Details:      
 
Domain Number 12 Region: 1131-1239
Classification Level Classification E-value
Superfamily E set domains 1.87e-26
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 13 Region: 2191-2283
Classification Level Classification E-value
Superfamily E set domains 2.4e-26
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 14 Region: 643-752
Classification Level Classification E-value
Superfamily E set domains 3.2e-26
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 15 Region: 1997-2093
Classification Level Classification E-value
Superfamily E set domains 5.4e-26
Family Filamin repeat (rod domain) 0.00000408
Further Details:      
 
Domain Number 16 Region: 252-364
Classification Level Classification E-value
Superfamily E set domains 5.4e-26
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 17 Region: 537-639
Classification Level Classification E-value
Superfamily E set domains 4.4e-25
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 18 Region: 833-943
Classification Level Classification E-value
Superfamily E set domains 1.33e-24
Family Filamin repeat (rod domain) 0.00051
Further Details:      
 
Domain Number 19 Region: 2289-2380
Classification Level Classification E-value
Superfamily E set domains 5.6e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 20 Region: 1907-1996
Classification Level Classification E-value
Superfamily E set domains 1.47e-18
Family Filamin repeat (rod domain) 0.00000823
Further Details:      
 
Domain Number 21 Region: 951-1051
Classification Level Classification E-value
Superfamily E set domains 4.4e-18
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 22 Region: 2104-2189
Classification Level Classification E-value
Superfamily E set domains 4.94e-18
Family Filamin repeat (rod domain) 0.0000203
Further Details:      
 
Domain Number 23 Region: 1744-1819
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000267
Family Filamin repeat (rod domain) 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000021837   Gene: ENSOANG00000013849   Transcript: ENSOANT00000021840
Sequence length 2410
Comment pep:novel supercontig:OANA5:Contig964:110443:222927:1 gene:ENSOANG00000013849 transcript:ENSOANT00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPSKPVDNAREAMQQADDWLGVPQVITPEEIIHPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQLARFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKSKTYSVQYMPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGVETSGVIANKPTYFDIYTAGAGVGDLGVEVEDPQGKKNIEMLIEDKGNQVFRCAYKP
THPGLHVVKVSFAGELIPKSPFSVNVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGEVKVIVKGPKGLEELVKQKDFMDGVYAFGYYPGIPGKYVVIITWGGHNIPKSPFE
VQVGPEAGVQKVRAWGPGLHGGVVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECEDQN
DGSCDVKYWPREPGEYAVHIMCDDEDIKNSPYMALIQPTSEDFSPDLVKAYGRGLEKTGC
IVNDPAEFTVDTKAAGKAPLKIYAQDGEGNSIDVHILNKMDGIYTCSYTPLKPIKHTFAI
VWGEVDIPNSPFRVVIGQGSHPQRVRVFGPGVERTGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYMPPASGRYTIKVLFASQEIPASPFHVKID
PSHDANKVKAEGPGLSKAGVENGKPTHFTVFTKGAGKAPLDVQFNGPLPGEAVKDLDIID
NYDYSHTVKYTPLQQGNTQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFTVDIKGAGGQGKVDVTILTPGRKVLPCLMEPVVGKDCSTAKYIPKEEGLYVVDVSY
DGNPVPGSPYNVEASLPPDPTKVRAHGSGLRGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVAYLPTKPGDYFVNILFEDVHIPGSPFQADIEMPFNASKVIATG
PGLECGKVGEAGLLNVDCSEAGPGDLGLEAISDSGAKAQVQVEDNKDGTYAVTYLPLSAG
MYTLMMKYGGEQVPKFPARVKVEPAVDTSKIRAFGPGIEGKDVFREATTNFTVDARSLTK
VGGDHIKALVTSPSGASTNCPIEDHADGTYSAEYTPFEKGPHIVEVTYDNVPVAQSPFKV
GVTEGCHSSRVKTHGPGLKEAFTNKPNGFSVVTRGAGIGGLGITVEGPSESKISCKDNKD
GSCSAEYIPFAPGDYDVNITYGGEHIPGSPFRVPVKDVVDSSKIKVAGPGITTGVRARIR
QSFTVDSSKAGFAPLEVRVVGPRGLIDPVNVMDNGNGTHTITYTPSQEGPYTISVKYADE
EIPRSPFKIKVLPTYDASKVTANGPGLSSYGVPASLPVDFAIDAKDAGEGLLAVQITDQE
GKLKRADIHDNKDGTFSVTYIPDKTGRYVIGVTYGGDEIPASPYRIRATPTGDASKCMAT
GPGIASTVKTGEELGFVVDAKTAGKGKVTCTVLTPDGTETEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMAADDEVAVMEEAPVNAFLPGYNPWVTEEAYVPGSDVN
GLGFKPFDMVIPFAVRKGEITGEVHMPSGKTASPEIVDNKDGTVTVRYAPVEVGLHEMHI
KYIGNHIPESPLQFYVNYPNSGSVSAFGPGLVYGVANKTSTFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDIQETDLSTLTASIKAPSGHDEPCLLKRLPNNHIGISFIPHEVGQHVVSIKK
NGSHVPNSPVSIMVVQSEIGDARRAKVSGQGLTEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGIYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATIGSICDLNLKIPEIDSGEMSAQVTSPSGRITEAEIVPMGKSSHCVRFIPE
EMGVHTVAARYQNRHVPGSPFQFTVGPLGEGGAQNVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEIAFDDHKNGSCGVSYIAQEPGDYEVSVKFNDEHIPDSPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQGGNPTLVSAYGAGLEGGTTG
KQLHAIQSCR
Download sequence
Identical sequences F7FUH4
ENSOANP00000021837 ENSOANP00000021837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]