SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000022138 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000022138
Domain Number 1 Region: 766-873
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 2 Region: 953-1048
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000677
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 1072-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000746
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000022138   Gene: ENSOANG00000014040   Transcript: ENSOANT00000022142
Sequence length 2311
Comment pep:known_by_projection chromosome:OANA5:4:24944932:25196290:-1 gene:ENSOANG00000014040 transcript:ENSOANT00000022142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAMSLTLSPMRSQDMDPMATDASPMATNLTPTVEQEEGEDGLKEMDPDQRYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSRHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHTVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEDRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGAL
GDMAAGQAKPKSFDSWSYREMEKDFPELMRSVGLLTVAGDALLPPGSGAIDEDVMHSTPP
AEDEGQMEGSRAPPPVKELPPDSSPPGPAGPDPPTVSQPTVEPVKPEGPKPQQLPTCESA
TPKRPIRDCFNYNEDSPTQPSRPKRGLFLQQEAFPGGGDGRALNPPGTLSKPALSRSTPS
LLDPPDRSKLCLDLQASYPSGLAAVSQSYECLHRTGDGAPERPSRGPSKENSASLSRLSE
RSRKEKLRHKKVPEAPKGVFCRSSRGELVPAPNQPVQSRGNLAGKQGSTPCTPKSREKPR
ARAASPTAGGPGAQGTPQAELQSQAEPPGSPPSIQDRASPPGSTPTLSPPPKDKNKKSYF
SSPSHVTRNGSVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGETIQNIDD
WELSEMNSDSELYPTYQVRKKHKRFGRASPSSSSDAASSLEESVESGPLSEILSDEELFG
PVLAIKKWTVERLEGNAITEKNESAAAKSAIIQQLMQDIQHQENYEAIWEKIEGFVNKLD
EFIQWLNEAMETTENWTPPKAETDGLKLYLETHLSFKLNVDSHCALKEAVVEEGQQLLEL
IVSHKSAGLKDMLQMIASQWKELQRQIKRQHSWILRALDIIKAEILATDVSVEEEEGNGS
PKTEVQLCYLEAQRDAVEQMSLKLYSEQYASSSKRKEEFADMSKVHTAGSTGLLDFDSEY
QELWDWLIDMESIVMDSHDLLMSEEQQQHLYKQYSVEMSIRHPKKMELLSKVEALKKGGV
LLPNDLLEKVDSINEKWELLAKTLGKKIQDTMVGHSGLGPRDLLSPESGSLVRQLEVRIK
ELKGWLRDTELFIFNSCLRQEKEGTMNAEKQLQYFKSLCGEIKQRRRGVASVLRLCQHLL
DDQETCNLSADHQSMQLIIVNLERRWEAIVMQAVQWQTRLQRKLGNGPEILNVIEQGLVD
LNGANEDALEWDETDIGNKLISIHEDANGLDQEQNPAMPNMKPESEDPDREERSYEGYAE
EPGRARYSPSIPGPTSPQIYQVYSLHNIELYDENHMTFRQTSPKFPGLTHPMALTKSLSN
DSSFSSTKSLPDLLGGIPLVKPGLSRGGDISLHSGSESGIVSEGDPETTTNSEVCLVKDR
DGTQSNPETGHPAPQMKEVVNALRQKLKDEEGHIPLSKNYQSPPSPVSCINGKDGDLNSV
TKSSSVCLEDELRGKPDVLTFHDYSYLQGPKLKFPVIAKQSKSERVHAEETLLHGLHCDK
TPCKSKQVIEPQPDKSPHELTLASAAPETDPGSSKSEDGGKASAGMQTGKQPSFLSCSSS
LESLSPGGNMFGLGIFKNGECLQRSISLESWLTSYKSNEDLFSPHSSGDVSVSSGSVGEL
SKRTLDLLNRLENIQSPSEQKIKRSISDITLQSSSQKMSFTGHSLDIASSVNGDSAASLT
ELSSSDELSLCAEDIVLHRNKLPDSNASFRKRLTRSVADESDVNVSMIVNVSCTSACTDD
EDDSDLLSSSTLTLTEEELGLKDEDDSSIATDDDLYEECNIISGLDYIKNELQTWMRPKF
SLTREKRKCNHSDEIQSGRDINGGETLNPTDMLNIEALLNGSVELSENNGNDGKNVSNTQ
ELGTKDQNKKNSSKVEKDPLVDDMENGNVESVPAGKKEEVGRMSTMAENCDPVGKKAPES
EWCVCEAFTDSSDDSNMDGKEIVSSPKASRSPPKQLLNHLSPDDPNVAFSLTGNPGPEST
PENRVMEVPDSTFLASSPVSEQSIAEKTNCFLALKPNEADKSPAEEGLTSCCNCMPGVMD
EKGAKDCSVHSFVKEIIDLASTALKNKTQPENEAASPTSLAQIKEKVLEHSHRPIHLRKG
DFYSYLSLSSHDSDCGEVTNYVEEKSNTPLPLDFSESGLEDKEDVECFFEACTEDDINEK
ESPFTQIPSNETPGPGKEPISPEILTSSSNRVDLSSSSDHTGKAGSKPVPQKVPTLPTEL
GGEPQISDHCEESSNPSSSKPSSGKGRSGNLDGIDMPRGMGVALAKTSSPDLPVKPEELM
DQAELHPNAKTLTCEENLLNLHQERHINMHR
Download sequence
Identical sequences F6Q8W7
ENSOANP00000022138 9258.ENSOANP00000022138 ENSOANP00000022138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]