SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000022310 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000022310
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily EF-hand 5.09e-23
Family S100 proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000022310   Gene: ENSOANG00000014144   Transcript: ENSOANT00000022314
Sequence length 101
Comment pep:known_by_projection supercontig:OANA5:Contig11856:14775:18211:-1 gene:ENSOANG00000014144 transcript:ENSOANT00000022314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHPLEQALEVMISTFHKYSGKDGDKFKLNKTELKDLLTKELPSFIGKRDDEAGLQKLMS
TLDNNQDNQVDFQEYACFLACVAMMCNTSFHGCPDKMPRRK
Download sequence
Identical sequences F6Q7T6
ENSOANP00000022310 9258.ENSOANP00000022310 XP_001513231.1.37387 ENSOANP00000022310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]