SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000022998 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000022998
Domain Number 1 Region: 51-143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000102
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000022998   Gene: ENSOANG00000014599   Transcript: ENSOANT00000023002
Sequence length 159
Comment pep:known_by_projection supercontig:OANA5:Contig6118:11378:19062:-1 gene:ENSOANG00000014599 transcript:ENSOANT00000023002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLCGQYQEDAADLKDVAKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKY
RKQMLQLMIAKKAVDAEPVLKAHQSHSAEIESQIDRIYEMGEVMRKAVQVDDHQFCKIQE
KLAQLELENKELRELLSISKESLQMKKEESMDSASQDTK
Download sequence
Identical sequences F7BB48
ENSOANP00000022998 ENSOANP00000022998 9258.ENSOANP00000022998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]