SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000023140 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000023140
Domain Number - Region: 119-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.035
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000023140   Gene: ENSOANG00000014685   Transcript: ENSOANT00000023144
Sequence length 219
Comment pep:novel supercontig:OANA5:Contig1626:145737:151643:1 gene:ENSOANG00000014685 transcript:ENSOANT00000023144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQERRGAVARGRGFWHCPRPAYSPQTRELLRVMMQESKLNNFQQRQIRDSMKRGDALP
VECHPTSSQKPSSPPKPTTHPPGLRLPPILSTRPRRRPANICQANDAYIREQYRPRATRD
LEKEKQRLQNIFATGKDVEERKRKQKPVVQEEPAPEPDRFEELVNEVRERREFLLQMEAL
GRGKQYRGIILTEMSQKLREMEDLDKQRSRRLKEAVARA
Download sequence
Identical sequences F7GBE7
9258.ENSOANP00000023140 ENSOANP00000023140 ENSOANP00000023140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]