SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000023328 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000023328
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000706
Family Toll/Interleukin receptor TIR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000023328   Gene: ENSOANG00000014811   Transcript: ENSOANT00000023332
Sequence length 117
Comment pep:known ultracontig:OANA5:Ultra312:156453:156806:-1 gene:ENSOANG00000014811 transcript:ENSOANT00000023332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGRHHLQNLDDAVNGSAWTILLLTENFVSEAWCRFQFHTSLVNSVNRQHKYNSVIPVR
PLNNPLPRQKTPFALRTISALEEGSCAFPTQVGKIFQESVYRKQEAIWRDAKTAAKR
Download sequence
Identical sequences F6PUF0
ENSOANP00000023328 ENSOANP00000023328 9258.ENSOANP00000023328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]