SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000023506 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000023506
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000159
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 115-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000713
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 144-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000713
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000023506   Gene: ENSOANG00000014933   Transcript: ENSOANT00000023510
Sequence length 612
Comment pep:novel chromosome:OANA5:2:28639258:28653454:1 gene:ENSOANG00000014933 transcript:ENSOANT00000023510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFQVAEEKLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGIAGVKRPPED
SKEQPVGKKVTTRPVQPTPPTPSSGKPLTPARTNPAVPTKSVSVGGSDRSQGTVSSDCAV
CGRHVHLVQRHLVDGKLFHRNCFRCKQCSNTLHSGTYRPAEEPGSFLCINHHPKASTPPA
SSPVSAKKLPGPASTPRGQAGPMDITRSGFQTPKARESEKAGETGLRTPGYRPAGNGAPE
SLVRPNLWSPTPRTGSTVPSASPGLNPPKPPPSSFQSTPSFSKSHIARDSSPPTSRAGKV
PDRSPVGWPPTAQSRSSTQVTPSSSPWTASAVKTQQAREKFFQLTSSASPGPGPEAEGPR
GSPTAKQEAVSTRPRPGRSQASLQGAGAKGPASGSSTTFSTTAGQKRESPASLQDPEAPS
HCETRKGPSPATSPTSRLLPSPNPVSIFPIAFRHQSPFTDFAHLIGKNTRPASVLSLFLG
QGSCSSKDIGGGPEGWRAKLKPVEKKSGAERKVLDPKEKSRPAEESGIGVLKKSPGSSVV
TIQINVSPAQKEHKVAPVSPSPPKPSPGLTASSTSPAQPRKRLIPQNLDLSIHWLSPEQK
WEESVLPSGKEQ
Download sequence
Identical sequences F6QP73
ENSOANP00000023506 ENSOANP00000023506 9258.ENSOANP00000023506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]