SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000023590 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000023590
Domain Number 1 Region: 33-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.2e-39
Family SCAN domain 0.0000339
Further Details:      
 
Domain Number 2 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-16
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 227-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000183
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 5 Region: 441-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000341
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000023590   Gene: ENSOANG00000014990   Transcript: ENSOANT00000023594
Sequence length 558
Comment pep:known_by_projection supercontig:OANA5:Contig2498:18746:27556:-1 gene:ENSOANG00000014990 transcript:ENSOANT00000023594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAPSSPARAPREHEGPLTVQVAEDSVWGQDDTGPESFRQRFRWFRYQEAAGPREAHSR
LRELCRRWLRPELRTKEQILELLVLEQFLTVLPREIQTQVRERRPESGEEAVALVEGLQR
ETRRPRRWVTVCVRGQEVLSEQTSALGHTPREPLTIQLDRSESLASPETPSRDIGSPDTP
GWDPEEEPPPSPTQERAPSAPRVPASPQDGSSTEREMAAALLAAGSQDVSLCFSQEEWGS
LDPGQTDFYGEYVMQENCGIVVSLSQPETPLYSQASLGSGDGEGGELPSPLLRDRVPNSQ
TGWLLPGGRRGRPVDAGLPGLRDSQSHLPRVLPHPPPQETVASPTEWCQCRSRSRPACRP
TGQRKPTPGAELTALRAGGFPGLLCRGELDSLMRSHLCPQCGKSFVWGSHLARHLQTHTG
ERPYRCPKCQKSFGRRHHLVRHQKTHLREKPSRCPDCGKVFRCPAHLASHQRAHAEGEEG
KPAKPRQVGEGPGKVRRRRAPPVERSHICGECGKSFGRRHHLVRHWLTHTGEKPFHCPQC
QKGFGRKHHLDRHLLTHQ
Download sequence
Identical sequences F7BWB7
ENSOANP00000023590 ENSOANP00000023590 9258.ENSOANP00000023590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]