SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000023973 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000023973
Domain Number 1 Region: 27-118
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-37
Family SCAN domain 0.0000376
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000023973
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0196
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000023973   Gene: ENSOANG00000030916   Transcript: ENSOANT00000023977
Sequence length 251
Comment pep:novel supercontig:OANA5:Contig6671:17389:26728:-1 gene:ENSOANG00000030916 transcript:ENSOANT00000023977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARGLPEEEGLLVVKLEEDGRRGDEPSPESSRRRFRRFRYREAAGPREALGRLRELCR
RWLRPERRTKEQILEQLVLEQFLTVLPEDIRARVWDRRPESAEEAVALVEDLKRHPSGRG
PQVAVRVQGPDVLSEEPGSPGGDWKPQCAQLDPAGVKPEGEPRETVTRDPLPAPEEPASP
KEEPRSLQESAVLARLPALPSVRTASDWEMAAESQEAPGHLSPAQKDLYEDGRQEDEANE
IPLGKDALPSE
Download sequence
Identical sequences F7BUI2
ENSOANP00000023973 ENSOANP00000023973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]