SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024030 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024030
Domain Number 1 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.98e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 439-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000312
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 105-143
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000144
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024030   Gene: ENSOANG00000015267   Transcript: ENSOANT00000024034
Sequence length 564
Comment pep:known_by_projection supercontig:OANA5:Contig1664:3062:9947:1 gene:ENSOANG00000015267 transcript:ENSOANT00000024034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSVCRFREISPWMMVTAIQAMERKIESQAVRLLALEEKAGGAEKTVVEFGNQLEGKWAVL
ETLLQEYGLLQRRLENMENLLRNRNFWILRLPPATNGEVPKVRGNLDQGQKELYKNVMGN
YETLVSLDYAISKPEILSRLEQGKEPCDVDRRGSKGPAAPSDSSPGGTEPLVPGPDLILQ
VKPEAERRAEDPPPSTGEAWGAPQLVAEDGPWAPSHLDPGAGEISVDGHTXPHSNFAASI
LADSWPASLPPPQPPAPGPDQLLKANTVASSEADVKIVIKTEVPEQEEEEGAAPAVSAEA
PPATFYGAGPAAGPFPSPGPGAAWETPAGLFPNQEPGPGEPAGQERELGLLIPILAQGDP
PPADWLLGGARWGWNLVPKPPGTLAYPFPPEGAAEGGGGTTGPSPRLLGEPYHLPGWAKG
SGPRGGARKRPASPPGERRLFTCTTCGKSFRLQGSLVAHQSTHGLRCGVCGRRFNRAAHL
IRHQMLHTGERPFPCTACDKRFTERSKLIDHYRTHTGVRPFKCVACGKSFIRKDHLRKHQ
RNLTEGRSTPGEPRTRSPPARPPP
Download sequence
Identical sequences F6RTR8
ENSOANP00000024030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]