SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024034 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024034
Domain Number 1 Region: 247-308
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 487-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 586-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000175
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000024034
Domain Number - Region: 148-230
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024034   Gene: ENSOANG00000015268   Transcript: ENSOANT00000024038
Sequence length 716
Comment pep:known_by_projection supercontig:OANA5:Contig1664:21659:35036:1 gene:ENSOANG00000015268 transcript:ENSOANT00000024038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRSSPLVPPTLSQQETLLRSATVSPQGLPSAVPLETPFLPRAAPKGLLLRSLASSEG
EETPLPMPLVFPRETLPPSPPPPERGSPPQTPPVLLKEPPLLSPAPREPETVLPSRPLLP
QGAPRPTPRIPDPRPPAPPPKESPLQAAEISLLAVVAAVQAVERKVEAQAVRLLSLEGRA
GSAEKKLADCEKTAVDFANHLEGKWAVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLP
PGSNGEVPKVPVTFDDVAVHFSEQEWGNLSEWQKELYKNVMRGNYESLVSMDYAISKPDL
MSQMERGERPGPGQEPEDSEMPTDPSAAHDGIVIKIEVQANDEGPETAASPEPLAGQVED
HGFQDVDPGACCEEPPAMDLPPEASPHNGREFDLKQMLAHQRNCIAEGIVIKTEEQDEEE
EEEEEEEEPNRLQLRGALSGMLEAPLPRPHYNLDPTGRLVCACTQITICALFSIKPFFHT
GRGVQHNKSSLSKHQITHTGERPYTCPECKKSFRLQISLVIHQRAHAGERPFKCPECEKS
FSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHCAECGKRFTQK
HHLLEHQRAHTGERPYPCTHCASAPPPGRKERASAPHLPARPRRREMGTTPAPLLRPFRR
PGREPGSASRGVAGFRAPPGKERGGGGGEGETGRLLVDFLDNKMDEMNQHGGSDLA
Download sequence
Identical sequences F6RTL0
ENSOANP00000024034 ENSOANP00000024034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]