SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024035 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024035
Domain Number 1 Region: 432-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 337-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-17
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 131-192
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000131
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 
Domain Number 6 Region: 516-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000268
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000024035
Domain Number - Region: 43-110
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024035   Gene: ENSOANG00000031069   Transcript: ENSOANT00000024039
Sequence length 654
Comment pep:known_by_projection supercontig:OANA5:Contig1664:41118:57200:-1 gene:ENSOANG00000031069 transcript:ENSOANT00000024039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAECPEWGSGPPTAAPVVSSLTQLPAAEISLWTVVAAVQAVERKVGAQAARLLSL
EGRAGSAEKKLADCERTAAEFGSRLEGKWAVLETLLQEYGLLQRRLENMENLLRNRNFWI
LRLPPATNGEVPKVPVIIDDVAVYFSEQELGNLDQGQKELYKNATKGNYETLVSLDYAIS
KPDLLTQMERGEEPCGRDQPGAVEAGIPPHPAAEMESPTTPPVGLPWIKQEDESCGKAQQ
SPGKREISTDLCTADDWLMSKEKEKSTEMGQESPAPTWPPPGKAQGRLCQGAETGADRGA
CGSPARPPATRKAGPWEGDSGAPPAGPRRPGVPAAQKPYPCAECGKSFTRKEHCAQHQRV
HSGERPYACSQCPKSFAQQANLTSHARVHTGERAYTCAQCGKSFIHQSTLTTHYRTHTGE
KPYPCAECEKRFSRLSTLLEHRRTHTGEKPYQCAECERRFSRLSTLVEHRRTHTGEKPYQ
CAECEKRFTRLANLTVHQNTHAGERAYKCAECGKRFAQKPGFLRHLRGHTQEKLHPCAQC
GKSFVCRSWLVRHQLVHAGERPRPCADCERGCPPPGDPPPGPAGEGPGGPERLRPPEGPA
GNRRRKQPPGAPEGLRTPWENKGRQGPEQGGSQEGPAGPFHSPVSYVKMENGGL
Download sequence
Identical sequences F6RTI6
ENSOANP00000024035 ENSOANP00000024035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]