SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024036 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024036
Domain Number 1 Region: 133-179
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000024036
Domain Number - Region: 31-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.00255
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024036   Gene: ENSOANG00000015269   Transcript: ENSOANT00000024040
Sequence length 358
Comment pep:known_by_projection supercontig:OANA5:Contig1664:75179:80758:-1 gene:ENSOANG00000015269 transcript:ENSOANT00000024040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDARRAMPFQFPAFPERAPVFPDRMMREPQLPPAEISLWTVVAAIQAVERKVEAQASQLL
NLEGRTGTAEKKLADCEKTAAEFGNHVEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNF
WVLRLPPGSKGEVPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLLRENYKTLMSLGED
PEESVPKPDTLSRAEPRDESCAWEQNEPQAREIPMDPGPGAEALIPVADPSAQVKREVAL
GVRGQRGPGEGEPSADPGSDSPISTHDILSRIKQEEQPCVWDQQDLADREIPPDPGSCER
TAAKHPGMEACQPGCISPDSLISAHDILSWIKQEEEPYSWGPQESMDRDLTVDPGAGE
Download sequence
Identical sequences F6RTG9
ENSOANP00000024036 ENSOANP00000024036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]