SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024532 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024532
Domain Number 1 Region: 118-629
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.02e-155
Family Calponin-homology domain, CH-domain 0.00000000385
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000377
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024532   Gene: ENSOANG00000015575   Transcript: ENSOANT00000024536
Sequence length 636
Comment pep:known_by_projection ultracontig:OANA5:Ultra336:6698466:6757155:1 gene:ENSOANG00000015575 transcript:ENSOANT00000024536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSVSEEEMVELREAFSKVDTEGNGYISCNELNDLFKAACLPLPGYRVREIVENLMAT
GELNNGDKISFDEFISVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCKHVIPMNPDTDDLFNAVGDGIVLCKMINLSVADTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKVNNFSTDIKLTDFYS
ILKDSKAYYHLLEQVAPKGDEDGIPAIAIDMTGLREKDDLQRAECMLQQAERLGCRQFVT
ATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWSALEGETREERTFRNWMNSLGVTP
RVNHLYSDLSDALVIFQLYEKIKVPVDWNKVNKPPYPKLGGNMKKLENCNYAVELGKNQA
KFSLVGIAGQDLNEGNHTLTLALIWQLMRRYTLQILEDIGGGQKVNDDTIVSWVNDTLKE
AGKTSSISSFKDNKISTSMPVLDLIDAIQPGSIKYDLLKTEDLNDEEKLNNAKYAISMAR
KIGARVYALPEDLVEVKPKMVMTVFACLMGKGMKKV
Download sequence
Identical sequences F7DZQ5
ENSOANP00000024532 ENSOANP00000024532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]