SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024591 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024591
Domain Number 1 Region: 36-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-34
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 221-281
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 553-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 404-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024591   Gene: ENSOANG00000015609   Transcript: ENSOANT00000024595
Sequence length 613
Comment pep:known_by_projection ultracontig:OANA5:Ultra523:60286:74257:-1 gene:ENSOANG00000015609 transcript:ENSOANT00000024595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKAALESQTWDPTDKEGWPTMNLEQEWAPRTQSGIPLDAEICHQSFRQFRYQEMSGPREA
LSQLWELCRRWLRPEKHTKKQILELLVLEQFLTVLPGEIQAWVRIHRPEMDSRAVWAVEG
AQFTDRRRREWKAEMRISKFLNNRISKLGKAAEYKNTFIRAVGLDMGKLQPRKVILSPLA
RARSFLNGSCDWAFVSLQPTEPFLPTQSPRSSHTLCPDTARSPGSMTFEDVAVSLNQEEW
KILDPAQRSLYQEVMLENFGNLVSLGFPITKPDVISQLEDGKGLWFQDLPESEEKETPRD
ICEAITGNPSKNICEEAASQRALVVKNQQTISVTSEAEKTSEYKGILAKQSGNSTRRKLR
KFPNQEREFRNEMRRRIPSKKSSYECGKSFKWTLCLTEHTGKNTYSCSECGKTFSQHSGL
NNHQRIHTGEKPYKCNECGKGFSQHSGLNKHQRIHTGEKPFKCNECGKAFTDQSYLIKHH
RIHTGEKPYKCNECGKAFSRHSNFKTHGRIHTGEKPYKCDDCGKSFSQHSNFIKHQRIHT
GEKPYKCNRCGKAFSQNSSLNSHQRIHTAEKPYKCNECGKAFSQHSHRIRHQRIHTGEKP
YRKFKCYDCGKAY
Download sequence
Identical sequences F7DRA3
ENSOANP00000024591 9258.ENSOANP00000024591 ENSOANP00000024591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]