SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024777 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024777
Domain Number 1 Region: 26-82
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000013
Family Calmodulin-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024777   Gene: ENSOANG00000015720   Transcript: ENSOANT00000024781
Sequence length 164
Comment pep:known_by_projection supercontig:OANA5:Contig13233:21:6087:-1 gene:ENSOANG00000015720 transcript:ENSOANT00000024781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPSLVARARSPGLWSLTWPSCVPRYDAGRDGFIDLMELKLMMEKLEAPQTHLGLKNMI
KEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAK
VQAINVSCRFEEEIKAEQEEKKKQAEEMKQRKAAFKELQSAFKQ
Download sequence
Identical sequences F7EEZ2
ENSOANP00000024777 ENSOANP00000024777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]